Chromohalobacter salexigens: Csal_1602 Help Entry Csal_1602         CDS       T00347                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism csa  Chromohalobacter salexigens Pathway csa01100   Metabolic pathways csa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:csa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Csal_1602   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Csal_1602 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1896 Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  ABE58955 UniProt:  Q1QX53 LinkDB All DBs Position 1823065..1823298 Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNTSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVVAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtgaagaaggttgtggccgagcgcctgaacgtcaaggaa gaagacatccagaacacgtcttccttcaccgaggatctcggcgccgactcgctggatacc gtcgagctggtgatggcgctcgaagaggaattcgacaccgagattcccgatgaagaagcc gagaagatcaccaccgttcaggaagcgatcgactacgtcgtcgctcaccagtaa

DBGET integrated database retrieval system