KEGG   Chlorocebus sabaeus (green monkey): 103221718
Entry
103221718         CDS       T04361                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04022  cGMP-PKG signaling pathway
csab04141  Protein processing in endoplasmic reticulum
csab04151  PI3K-Akt signaling pathway
csab04211  Longevity regulating pathway
csab04261  Adrenergic signaling in cardiomyocytes
csab04668  TNF signaling pathway
csab04728  Dopaminergic synapse
csab04911  Insulin secretion
csab04915  Estrogen signaling pathway
csab04918  Thyroid hormone synthesis
csab04925  Aldosterone synthesis and secretion
csab04926  Relaxin signaling pathway
csab04927  Cortisol synthesis and secretion
csab04928  Parathyroid hormone synthesis, secretion and action
csab04934  Cushing syndrome
csab04935  Growth hormone synthesis, secretion and action
csab05020  Prion disease
csab05030  Cocaine addiction
csab05031  Amphetamine addiction
csab05034  Alcoholism
csab05161  Hepatitis B
csab05163  Human cytomegalovirus infection
csab05166  Human T-cell leukemia virus 1 infection
csab05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:csab00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103221718 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103221718 (ATF6B)
   04022 cGMP-PKG signaling pathway
    103221718 (ATF6B)
   04151 PI3K-Akt signaling pathway
    103221718 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103221718 (ATF6B)
   04915 Estrogen signaling pathway
    103221718 (ATF6B)
   04926 Relaxin signaling pathway
    103221718 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    103221718 (ATF6B)
   04918 Thyroid hormone synthesis
    103221718 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    103221718 (ATF6B)
   04925 Aldosterone synthesis and secretion
    103221718 (ATF6B)
   04927 Cortisol synthesis and secretion
    103221718 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103221718 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    103221718 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    103221718 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103221718 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    103221718 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    103221718 (ATF6B)
   05031 Amphetamine addiction
    103221718 (ATF6B)
   05034 Alcoholism
    103221718 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103221718 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103221718 (ATF6B)
   05161 Hepatitis B
    103221718 (ATF6B)
   05163 Human cytomegalovirus infection
    103221718 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:csab03000]
    103221718 (ATF6B)
Transcription factors [BR:csab03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103221718 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 103221718
NCBI-ProteinID: XP_007971217
Ensembl: ENSCSAG00000009237
UniProt: A0A0D9RA56
LinkDB
Position
17
AA seq 711 aa
MIGGWGGKMAELMLLSEIADPTRFFADNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCP
EQDVPFDGSSLDVGMDVSPPEPPWELLPILPDLQVKSEPSSPCSSSSRSSESSHLSTEPS
SEALGVGEVLHVKTESLAPPLCLLGDDPTSSFETVQINVVPTSDDCSDVQTKIEPVSPCS
SINSEASLLSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSPDGS
SGKALPIRKPPLQPKPVVLTTVPMPPRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQP
EGPAASLPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFG
PVSISEPPSAPISPRMNKGEPRPRRHLLGFSEQEPVHGVEPLQGSSQGPEEPQPSPTDQP
SFRNLTTFPGGTKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQ
RAQERQKSQPRKKSPPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTF
YVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDT
RVIHIKTSTVPPSLRKQPSPTPGNATGGPLPASAASQAHQASHQPLYLNHP
NT seq 2136 nt   +upstreamnt  +downstreamnt
atgattggggggtgggggggaaagatggcggagctgatgctcctcagcgagattgccgac
ccgacgcgtttcttcgccgacaacctgctaagcccggaggactggggtctgcagaacagc
accttgtattctggcctagatgaagtggccgaggagcagacgcagctcttccgttgcccc
gagcaggatgtcccgtttgacggcagctccctggacgtggggatggatgtcagcccccct
gagcccccatgggaactcctgccgatcttgccagatcttcaggtgaagtctgagccgtct
tccccctgctcttcctcctcccgcagctccgagtcatcacatctctccacagagccctcc
agcgaggctcttggggtaggggaggtgctccatgtgaagacagagtccttggcaccccca
ctgtgtctcctgggagatgacccaacatcctcatttgaaactgtccagatcaacgtagtc
cccacctctgatgattgctcagatgtccagaccaagatagaacctgtctctccatgttct
tccattaactctgaggcctccctgctctcagccgactcctccagccaggcttttatagga
gaggaggtcctggaagtgaagacagagtccctgtccccttcagggtgcctcctatgggat
gtcccagccccctcacttggagctgtccagatcagcatgggcccatcccctgatggctcc
tcagggaaagccctgcccatccggaagccgccactgcagcccaaacctgtggtgctaacc
actgtcccaatgccacccagagctgtgcctcccagcaccaccgtccttctgcagcccctc
gtccagccacccccagtatccccagttgtcctcatccagggtgctattcgagtccagcct
gaagggccggctgcctctctaccacggcctgagaggaagagcatcgttcctgctcctatg
cctggaaactcctgcccgcctgaagtggatgcaaagctgctgaagcggcagcagcgaatg
atcaagaaccgggagtcagcctgccagtcccggagaaagaaaaaagagtatctgcagggg
ctggaggctcggctgcaggcagtgctggctgacaaccagcagctccgccgggagaatgct
gccctccggcggcgactggaggccctgctggctgaaaacagcgagctcaagttagggtct
ggaaacaggaaggtggtctgcatcatggtcttccttctcttcattgccttcaactttgga
cccgtcagcatcagtgagcctccttcagctcccatctctcctcggatgaacaagggggaa
cctcgaccccggagacacttgctggggttctcagagcaagagccagttcatggagttgaa
cctctccaggggtcctcccagggccctgaagagccccagcccagccccacagaccagccc
agtttcaggaacctgacaaccttccctgggggcaccaaggagctactactaagagaccta
gaccagctcttcctctcctctgattgccggcacttcaaccgcaccgagtccctgaggctt
gctgacgagctgagtggctgggtccagcgccaccagagaggccggcggaagatccctcag
agggcccaggagagacagaagtctcagccacggaagaagtcacctccagttaaggcagtc
cccatccaaccgcctggacccccggaaagggattctgtgggccagctgcagctatatcgc
cacccagaccgttcacagccagcgttcttggatgcaattgaccgacgggaagacacgttt
tatgttgtctctttccgaagagaccacctgctgctcccagccatcagccacaacaagacc
tcccggcccaagatgtccctggtgatgccggccatggcccccaatgagaccctgtcaggc
cgtggggccccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacacc
agggtgattcacatcaagacctccacggtacccccctcgctccgaaaacagccatcccca
accccaggcaatgccacaggtggccccttgccagcctctgcagccagccaggcccatcag
gcctcccatcagcccctctacctcaatcatccctga

DBGET integrated database retrieval system