KEGG   Chlorocebus sabaeus (green monkey): 103224871
Entry
103224871         CDS       T04361                                 

Gene name
CYP4A22
Definition
(RefSeq) cytochrome P450 family 4 subfamily A member 22
  KO
K07425  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00071  Fatty acid degradation
csab00590  Arachidonic acid metabolism
csab00830  Retinol metabolism
csab01100  Metabolic pathways
csab03320  PPAR signaling pathway
csab04270  Vascular smooth muscle contraction
csab04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103224871 (CYP4A22)
   00590 Arachidonic acid metabolism
    103224871 (CYP4A22)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    103224871 (CYP4A22)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    103224871 (CYP4A22)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103224871 (CYP4A22)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103224871 (CYP4A22)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:csab00199]
    103224871 (CYP4A22)
Enzymes [BR:csab01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     103224871 (CYP4A22)
Cytochrome P450 [BR:csab00199]
 Cytochrome P450, animal type
  CYP4 family
   103224871 (CYP4A22)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 103224871
NCBI-ProteinID: XP_007977043
LinkDB
Position
20
AA seq 377 aa
METFPSACPLWLWGGKARVLLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQT
WFQHRRMLTPAFHYDILKAYVGLMADSVRVMLDKWEKLLGQDSPLEVFQHVSLMTLDTIM
KCAFSHQGSVQVDRDSQSYIQAISDLNNLTFSRARNVFHQNDTIYSLTSAGRWTHRACQL
AHQHTDQVIQLRKAQLQKEGELEKVKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTF
MFEGHDTIASGISWILYALATHPKHQERCREEIHGLLGDGASITWNHLDQMPYTTMCIKE
ALRLYPPVPSIGRELSTPVTFPDGRSLPKGIMVMLSIYGLHHNPKVWPNPEVFDPSRFAP
GSAQHSHAFLPFSGGSR
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggagacattcccaagtgcctgtcctctttggctatggggaggcaaagctcgtgtcctg
ctctatgaccctgactatatgaaggtgattctggggagatcagacccgaaatcccatggt
tcctacagattcctggctccatggattgggtacggcttgctcctgttgaatgggcagaca
tggttccagcaccgacggatgctgaccccagccttccactatgacatcctgaaggcctac
gtggggctcatggcagactctgtacgagtgatgctggacaaatgggaaaagctccttggc
caggattcccctctggaggtctttcagcacgtctcgttgatgaccctggacaccatcatg
aagtgtgccttcagccaccagggcagcgtccaggtggacagggattctcagtcctacatc
caggccattagtgacctgaacaatctgactttttcccgagcgcggaacgtctttcaccag
aatgacaccatctacagcctgacctccgctggccgctggacacaccgcgcctgccagctc
gcccatcagcacacagaccaagtgatccaactgaggaaggctcaactacagaaggagggg
gagctggagaaggtcaagaggaagaggcacttggatttcctggacatcctcctcttggcc
aaaatggagaatgggagcatcttgtcagacaaggacctccgtgctgaagtggacacgttc
atgttcgagggccacgacaccatagccagtgggatctcctggatcctgtatgcgctggcc
acacaccccaagcatcaggagaggtgccgggaagagatccatggcctcctgggtgatgga
gcctccatcacctggaaccacctggaccagatgccctacaccaccatgtgcattaaggag
gcactgagactctacccaccggtgccaagcattggcagagagctcagcactcccgtcacc
ttccctgatgggcgctccttgcccaaaggtatcatggtcatgctctccatttatggcctt
caccacaacccaaaagtgtggcccaacccagaggtgtttgacccttcccgttttgcaccg
ggttctgctcaacacagccacgctttcctgcccttctcaggaggatcaaggtga

DBGET integrated database retrieval system