KEGG   Chlorocebus sabaeus (green monkey): 103227676
Entry
103227676         CDS       T04361                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04014  Ras signaling pathway
csab04390  Hippo signaling pathway
csab04392  Hippo signaling pathway - multiple species
csab05200  Pathways in cancer
csab05206  MicroRNAs in cancer
csab05219  Bladder cancer
csab05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103227676 (RASSF1)
   04390 Hippo signaling pathway
    103227676 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    103227676 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103227676 (RASSF1)
   05206 MicroRNAs in cancer
    103227676 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    103227676 (RASSF1)
   05223 Non-small cell lung cancer
    103227676 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH DUF2252
Other DBs
NCBI-GeneID: 103227676
NCBI-ProteinID: XP_007982535
Ensembl: ENSCSAG00000014207
UniProt: A0A0D9RP04
LinkDB
Position
22
AA seq 345 aa
MRSFLGAKCACPRPGVPPPMTQELDPGDLRFSLNGCGAALARAHAHTDTRTRTHATGAVV
GGYGRAGPGGRAGAAMGEAETPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSLARRP
RRDQDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVS
VPSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLV
VDDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDA
FSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgaggtcattcctcggcgctaagtgtgcgtgtccccgccccggcgttcctcccccaatg
acacaagagctagatcccggcgatctacgtttcagtcttaacggttgcggcgcggcgctg
gcccgggcgcacgcgcacactgacacgcgtacacgcacgcacgcgaccggggcggtggtt
ggcggctacggacgcgcgggaccagggggacgggcgggtgcggcgatgggcgaggcggaa
acgccttctttcgagatgacctggagcagcacgacgagcagtggctactgcagccaagag
gactcggactcggagctcgagcagtacttcaccgcgcgaacctcgctagcgcgcaggccg
cgccgggaccaggacgagcccgtggagtgggagacacctgacctttctcaagctgagatt
gagcagaagatcaaggagtacaatgcccagatcaatagcaacctcttcatgagcttgaac
aaggacggttcttacacaggcttcatcaaggttcagctgaagctggtgcgccctgtctct
gtgccctccagcaagaagccaccctccttgcaggatgcccggcggggcccaggacggggc
acaagtgtcaggcgccgcacttccttttacctgcccaaggatgctgtcaagcacctgcat
gtgctgtcacgcacaagggcacgtgaagtcattgaggccctgctgcgaaagttcttggtg
gtggatgacccccgcaagtttgcactctttgagcgggctgagcgtcatggccaagtgtac
ttgcggaagctgttggatgatgagcagcccctgcggctgcggctcctggcagggcccagt
gacaaggccctgagcttcgtcctgaaggaaaatgactctggggaggtgaactgggacgcc
ttcagcatgcctgaactacataacttcctgcgtatcctgcagcgggaggaggaggagcac
ctccgccagatcctgcagaagtactcctattgccgccagaagatccaagaggccctgcac
gcctgccccctcgggtga

DBGET integrated database retrieval system