KEGG   Chlorocebus sabaeus (green monkey): 103234960Help
Entry
103234960         CDS       T04361                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab03030  DNA replication
csab03410  Base excision repair
csab03420  Nucleotide excision repair
csab03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:csab00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    103234960 (LIG1)
   03410 Base excision repair
    103234960 (LIG1)
   03420 Nucleotide excision repair
    103234960 (LIG1)
   03430 Mismatch repair
    103234960 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:csab03032]
    103234960 (LIG1)
   03400 DNA repair and recombination proteins [BR:csab03400]
    103234960 (LIG1)
Enzymes [BR:csab01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103234960 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     103234960 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103234960 (LIG1)
DNA replication proteins [BR:csab03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103234960 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103234960 (LIG1)
DNA repair and recombination proteins [BR:csab03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103234960 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     103234960 (LIG1)
   MMR (mismatch exicision repair)
    Other MMR factors
     103234960 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DUF1685 Presenilin DDR
Motif
Other DBs
NCBI-GeneID: 103234960
NCBI-ProteinID: XP_007995583
Ensembl: ENSCSAG00000002897
UniProt: A0A0D9S2P9
LinkDB All DBs
Position
6
AA seq 919 aa AA seqDB search
MQRSIMSFFHPKKEGKAKKPEKEASNVSRDTEPPLKAALKEWNGVVSESDSPVKRPGRKA
ARVLGSEGEEEDEALSPAKGQKPAPDCSQVSPPHPATSPENNASLSDTSPMDSSPSGIPK
RRTARKQLPKRTIQEVLEEQSADEDREAKRKKEEEEVETPEESLTEAEVATEKEGEDRDQ
PPTPPKPLKTSEAETPTESVSEPEVATRQELQEEEEQSKPPRGAPKTLSSFFTPRKPAIK
KEVKEEEPGAPGKEGAAEGPLDPSSYNPARNNYHPVEDACWKPGQKVPYLAVARTFEKIE
EVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVGDGVLLKAVAQ
ATGRQLESIRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIARLTGSAST
AKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAV
VDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPL
KPMLAHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHTLEGGEVKIFSRNQEDNTGKYPD
IISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF
DLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDVEQIAEFLEQSVKDSCE
GLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLL
ASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVTPDHWLDPSA
VWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQ
SQIQNQQGEDSGSDPEDTY
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcatcatgtcattcttccaccccaagaaagagggtaaagcgaagaagcct
gagaaggaggcatccaacgtcagcagagacacggagccccctctgaaggcggcactgaaa
gagtggaatggagtggtgtccgagagtgactctccagtaaagaggccagggaggaaggcg
gcccgggtcctgggcagcgaaggggaagaggaggatgaagcccttagccctgctaaaggc
cagaagcctgccccggactgctcacaggtctccccgccccatcctgccacatctcctgaa
aacaacgcttccctctctgacacctctcccatggacagctccccatcagggatcccgaag
cgtcgcacagctcggaagcagctcccaaaacggaccattcaggaagtcctggaagagcag
agtgcggacgaggacagagaagccaaaaggaagaaggaggaggaagaagtggagacccca
gaagaaagcctcacagaggctgaagtggcaacagagaaggaaggagaagacagggaccag
ccccccacacctcccaagcccctgaagacctccgaagcagagaccccgacggaaagcgtt
tcggagcccgaggtggccacgaggcaggagctgcaggaggaggaagagcagagcaagcct
ccccgcggcgctcccaagacgctcagcagcttcttcacgccccggaagccagcaatcaaa
aaagaagtgaaggaggaggagccaggggctccaggaaaggagggagctgctgagggaccc
ctggacccatccagttacaatcctgccaggaacaactaccatcctgtggaagacgcctgc
tggaaacccggccagaaggtcccttacctggccgtggcccggacatttgagaagatcgag
gaggtgtctgcccggctccggatggtggagacactgagcaacttgctgcgctccgtggtg
gccctgtcgcctccagacctcctccctgtcctctacctcagcctcaaccaccttgggcca
ccgcagcagggcctggagcttggcgtgggtgatggcgtccttctcaaggcagtggcccag
gccacaggtcggcagctggagtccatccgggctgaggcagccgagaagggcgacgtgggg
ctggtggccgagaacagccgcagcacccagaggctcatgctgccaccacctccgctcact
gcttccggggtcttcagcaagttccgtgacatcgccaggctcactggcagtgcttccaca
gccaagaagatagacatcatcaaaggcctctttgtggcctgccgccactcagaagcccgg
ttcatcgccaggtccctgagcggacggctgcgtcttgggctggcagagcagtcggtgctg
gccgccctctcccaggctgtgagcctcacgcccccaggccaagaattcccaccagccgtg
gtggatgctgggaagggcaagaccgcagaggccagaaagacatggctggaggagcaaggc
atgatcctgaagcagacattctgcgaggtgcccgacctggaccgaattatccccgtgctg
ctggagcatggcctggaacgtctcccggagcactgcaagctgagcccagggattcccctg
aaaccaatgttggcccatcccacgcggggcgtcagtgaggtcctgaaacgctttgaggag
gcagctttcacctgcgaatacaaatacgatgggcagagggcacagatccacaccctggaa
ggcggggaggtgaagatcttcagcaggaatcaggaagacaacactggaaagtacccggac
atcatcagccgcatccccaagattaaactcccatcagtcacatccttcattctggacact
gaagccgtggcttgggaccgggaaaagaagcagatccagccattccaagtgctcaccacc
cgcaaacgcaaggaagtggatgcgtccgagatccaggtgcaggtgtgtttgtacgccttc
gacctcatctacctcaatggagagtccctggtacgtgagcccctttcccggcgccggcag
ctgctccgggagaactttgtggagacggagggcgagtttgtcttcgccacctctctggac
accaaggacgtcgagcagatcgccgagttcctggagcagtcggtgaaagactcctgtgag
gggctgatggtgaagaccctggatgtcgatgccacctacgagatcgccaagagatcgcac
aactggctcaagctgaagaaggactaccttgatggcgtgggtgacaccctggacctggtg
gtgatcggcgcctacctgggccgggggaagcgggccggccggtacgggggcttcctgctg
gcctcctacgacgaggacagtgaggagctgcaggccatatgcaagcttggaactggcttc
agcgacgaggagctggaggagcatcaccagagcctcaaggccctggtgctgcccagcccc
cgcccttatgtgcggatagatggtgccgtgactcccgaccactggctggaccccagtgct
gtgtgggaggtgaagtgtgccgacctctccctctcccccatctaccctgctgcgcggggc
ctggtggatagtgacaaggggatctcccttcgcttccctcggtttattcgggtccgtgaa
gacaagcagccggagcaggccaccaccagtgcacaggtggcctgtttgtaccggaagcaa
agtcagattcagaaccaacaaggcgaggactcaggctctgaccctgaagatacctactaa

DBGET integrated database retrieval system