KEGG   Chlorocebus sabaeus (green monkey): 103238826
Entry
103238826         CDS       T04361                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04010  MAPK signaling pathway
csab04014  Ras signaling pathway
csab04015  Rap1 signaling pathway
csab04072  Phospholipase D signaling pathway
csab04151  PI3K-Akt signaling pathway
csab04640  Hematopoietic cell lineage
csab04916  Melanogenesis
csab05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103238826 (KITLG)
   04014 Ras signaling pathway
    103238826 (KITLG)
   04015 Rap1 signaling pathway
    103238826 (KITLG)
   04072 Phospholipase D signaling pathway
    103238826 (KITLG)
   04151 PI3K-Akt signaling pathway
    103238826 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103238826 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    103238826 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103238826 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:csab04052]
    103238826 (KITLG)
Cytokines and growth factors [BR:csab04052]
 Growth factors
  Growth factors (RTK binding)
   103238826 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 103238826
NCBI-ProteinID: XP_008002401
Ensembl: ENSCSAG00000003781
UniProt: A0A0D9QUW0
LinkDB
Position
11
AA seq 273 aa
MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPG
MDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSS
KDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVT
KPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPAFFSLIIGFAFGALYWKKR
QPSLTRAVENIQINEDDNEISMLQEKEREFQEV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattctcacttgcatttatctccaactgctcctatttaat
cctctcgtcaaaactgaagggatctgcaggaatcgtgtgactaataatgtaaaagacgtc
actaaattggtggcaaatcttccgaaagactatatgataaccctcaaatatgtccccggg
atggatgttttgccaagtcattgttggataagcgagatggtagtacaattgtcagacagc
ttgactgatcttctggacaagttttcaaacatttctgaaggcttgagtaattattccatc
atagacaaacttgtcaatatagtggatgaccttgtggagtgcgtgaaagaaaactcatct
aaggatctaaaaaaatcattcaagagcccagaacccaggctctttactcctgaagaattc
tttagaatttttaatagatccattgatgccttcaaggactttgtagtggcatctgaaact
agtgattgtgtggtttcttcgacattaagtcctgagaaagattccagagtcagtgtcaca
aaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagcagt
aataggaaggccaaaaatccccctggagactccagcctacactgggcagccatggcattg
ccagcattcttttctcttataattggctttgcttttggagccttatactggaagaagaga
cagccaagtcttacaagggcagttgaaaatatacaaattaatgaagacgataatgagata
agtatgttgcaagagaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system