KEGG   Chlorocebus sabaeus (green monkey): 103242600
Entry
103242600         CDS       T04361                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00220  Arginine biosynthesis
csab00330  Arginine and proline metabolism
csab01100  Metabolic pathways
csab04020  Calcium signaling pathway
csab04066  HIF-1 signaling pathway
csab04146  Peroxisome
csab04371  Apelin signaling pathway
csab04926  Relaxin signaling pathway
csab05010  Alzheimer disease
csab05014  Amyotrophic lateral sclerosis
csab05022  Pathways of neurodegeneration - multiple diseases
csab05133  Pertussis
csab05140  Leishmaniasis
csab05142  Chagas disease
csab05145  Toxoplasmosis
csab05146  Amoebiasis
csab05152  Tuberculosis
csab05200  Pathways in cancer
csab05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    103242600 (NOS2)
   00330 Arginine and proline metabolism
    103242600 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103242600 (NOS2)
   04066 HIF-1 signaling pathway
    103242600 (NOS2)
   04020 Calcium signaling pathway
    103242600 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103242600 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103242600 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103242600 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    103242600 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103242600 (NOS2)
   05014 Amyotrophic lateral sclerosis
    103242600 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    103242600 (NOS2)
   05152 Tuberculosis
    103242600 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103242600 (NOS2)
   05145 Toxoplasmosis
    103242600 (NOS2)
   05140 Leishmaniasis
    103242600 (NOS2)
   05142 Chagas disease
    103242600 (NOS2)
Enzymes [BR:csab01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     103242600 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 103242600
NCBI-ProteinID: XP_008008949
Ensembl: ENSCSAG00000007474
LinkDB
Position
16
AA seq 1153 aa
MACPWKFLFKTKFHQYTMTGGKDINNNMEKAACATSSLVTQDDLQYHSLSKQQNDSPQPL
VGTGKKSPESLVKPDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARNCSTAREMFEHICRHVRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVVPLVLQADGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT
ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYSLSCLEEERLLLVVTSTFGNGDCPG
NGEKLKKSLFMLKELTNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD
ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSSVTWDPHHYRLVQDSQPLDL
SKALSNVHAKNVFTMRLKSRQNLQSPTSSRATVLVELSCEDGQDLNYLPGEHLGVCPGNQ
PALVQGILERVVDSPAPHQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ
LLLQKLAQVATEVTERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTQDGQGPLHHGVCSTWLNSLKPQDPVPCF
IRNASGFHLPEDPSHPCILVGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPD
EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHEEPGHLY
VCGDVRMAWDVAHTLKQLVAAKLNLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEVKKDG
AAVQPRSLEMSAL
NT seq 3462 nt   +upstreamnt  +downstreamnt
atggcctgtccttggaaatttctgttcaagaccaaattccaccagtatacaatgactggg
ggaaaagacatcaacaacaacatggagaaagctgcctgtgccacctccagtctagtgaca
caggatgaccttcagtatcacagcctcagcaagcagcagaatgattccccgcagcccctc
gtggggacaggaaagaagtctccagaatctctggtcaagccggatgcaaccccattgtcc
tccccacggcacgtgaggatcaaaaactggggcagcgggatgactttccaggacacactt
caccacaaggccaaagggattttgacttgcaggtccaaatcttgcttggggtccattatg
actcccaaaagtttgaccagaggacccagggacaagcctacccctccagatgagcttcta
cctcaagctatcgaatttgtcaaccaatattacggctccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccaa
ctgacgggagatgagctcatcttcgccaccaagcaggcctggcgcaatgccccacgctgc
attgggaggatccagtggtccaacctgcaggtcttcgatgcccgcaactgttccaccgcc
cgggaaatgtttgaacacatctgcagacacgtgcgttactccaccaacaatggcaacatc
aggtcggccatcaccgtgttcccccagcggagcgatggtaagcacgacttccgggtgtgg
aatgctcagctcatccgctacgcgggctaccagatgccagatggcagcatcagaggggat
cctgccaacgtggaattcactcagctgtgcatcgacctgggctggaagcccaagtatggc
cgcttcgatgtggtccccctggtcctacaggctgacggccgtgaccctgagctcttcgaa
atcccacctgaccttgtgcttgaggtggccatggaacatcccaaatatgagtggtttcgg
gaactggagctaaagtggtatgccctgcctgcagtggccaacatgctgctcgaggtgggc
ggcctggagttcccagggtgccccttcaatggctggtacatgggcacagagatcggagtc
cgggacttctgtgacgtccaacgctacaacatcctggaggaagtgggcaggagaatgggc
ttggaaacgcacaagctggcctccctctggaaagaccaggctgtcgttgagatcaacatt
gctgtgctccatagtttccagaagcaaaacgtgaccatcatggaccaccactcagctgca
gaatccttcatgaagtacatgcaaaatgaataccggtcccgtgggggctgcccggcagac
tggatttggctggtccctcccatgtctgggagcatcactcccgtgtttcaccaggagatg
ctgaactacgtcctgtcccctttttactactatcaggtagaggcctggaaaacccatgtc
tggcaggacgagaagcggagacccaagagaagagagattccgttgaaagtcttggtcaaa
gctgtgctcttcgcctgtatgctgatgcgtaagacgatggcgtcccgagtcagagtcacc
atcctctttgcgacagagacaggaaaatcagaggcgctggcctgggacctgggggccttg
ttcagctgtgccttcaaccccaaggttgtctgcatggacaagtacagtctgagctgcctg
gaggaggagcggctgctgttggtggtaaccagtacgtttggcaatggagactgccccggc
aacggagagaaactgaagaaatcgctcttcatgctgaaagagctcaccaacaaattcagg
tatgccgtgtttggcctcggctccagcatgtatcctcggttctgcgcctttgctcatgac
atcgatcagaagctgtcccacctgggggcctctcagctcacccctatgggagaaggggat
gagctcagtgggcaggaggacgccttccgcagctgggccgtgcaaaccttcaaggcagcc
tgtgagacgtttgatgtccgaggcaaacagcacattcagatccccaagctctacacctcc
agtgtgacctgggacccacaccactacaggctcgtgcaggactcacagcctttggacctc
agcaaagccctcagcaacgtgcacgccaagaacgtgttcaccatgaggctcaaatctcgg
cagaatctacagagtccgacatccagccgtgccaccgtcctggtggaactctcctgtgag
gacggccaagacctgaactacttgccgggggagcaccttggggtttgtccaggcaaccag
ccggccctggtccaaggcatcctggagcgagtggtggacagcccggcaccccaccagaca
gtgcgcctggaggccctggacgagagtggcagctactgggtcagtgacaagaggcttccc
ccctgctcgctcagccaggccctcacctacttcctggatatcaccacccccccaacccag
ctgctgctccaaaagctggcccaggtggccacagaagtgactgagagacagaggctggag
gccctgtgccagccctcagagtacagcaagtggaagttcaccaatagccccacgttcctg
gaggtgctggaggagttcccatccctgcgggtgtctgctggcttcctgctttcccagctc
cccattctgaagcccaggttctactccatcagctcctcccgggatcacacacccacggag
atccacctgactgtggccgtggtcacgtaccacacccaagatggccagggtcccctgcac
catggcgtctgcagcacatggctcaacagcctgaagccccaagacccagtgccctgcttt
atacgaaacgccagcggcttccacctccccgaggacccctcccatccttgcatcctggtc
gggcctggcacaggcatcgcccccttccgcagtttctggcagcagcggctccatgactcc
cagcacaagggagtgcggggaggccgcatgaccttggtgtttgggtgccgccgcccagat
gaggaccacatctaccaggaggagatgctggagatggcccagaagggggtgctgcatgcg
gtgcacacagcctattctcgcctacctggcaagcccaaggtctatgttcaggacatcctg
cggcagcagctggccagcgaggtgctccgtgtgctccacgaggagccgggccacctctat
gtttgtggggatgtgcgcatggcctgggatgtggcccacaccctgaagcaactggtggct
gccaagctgaacttgaatgaggagcaggtcgaggactatttctttcagctcaagagccag
aagcgctatcatgaagatatctttggtgctgtatttccctacgaggtgaagaaggacggg
gcggcagtgcagcccaggagcctggagatgtcagccctctga

DBGET integrated database retrieval system