KEGG   Chlorocebus sabaeus (green monkey): 103244501
Entry
103244501         CDS       T04361                                 

Gene name
IL3
Definition
(RefSeq) interleukin 3
  KO
K04736  interleukin 3
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04060  Cytokine-cytokine receptor interaction
csab04151  PI3K-Akt signaling pathway
csab04210  Apoptosis
csab04630  JAK-STAT signaling pathway
csab04640  Hematopoietic cell lineage
csab04664  Fc epsilon RI signaling pathway
csab05200  Pathways in cancer
csab05202  Transcriptional misregulation in cancer
csab05221  Acute myeloid leukemia
csab05310  Asthma
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103244501 (IL3)
   04151 PI3K-Akt signaling pathway
    103244501 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103244501 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103244501 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103244501 (IL3)
   04664 Fc epsilon RI signaling pathway
    103244501 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103244501 (IL3)
   05202 Transcriptional misregulation in cancer
    103244501 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    103244501 (IL3)
  09163 Immune disease
   05310 Asthma
    103244501 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:csab04052]
    103244501 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:csab00536]
    103244501 (IL3)
Cytokines and growth factors [BR:csab04052]
 Cytokines
  Interleukins
   103244501 (IL3)
Glycosaminoglycan binding proteins [BR:csab00536]
 Heparan sulfate / Haparin
  Cytokines
   103244501 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 103244501
NCBI-ProteinID: XP_008012541
LinkDB
Position
23
AA seq 199 aa
MSDKDPSDACTTPPAPRLARGCGHRAAAHIRREAVANSSEPHEGPEQDRVPPANPNMSLL
PVLLLLHLLVSPGLQAPMTQTTSLKISWANCSNMIDEIITHLNQPPLPSLDFNNLNGEDR
AILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRPPIRITNGDRN
DFRRKLKFYLKTLENEQAQ
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtcagataaagatccttccgacgcctgcaccacaccacccgccccccgccttgcccgg
ggttgtgggcaccgtgctgctgcacatataaggcgggaggctgttgccaactcttcagag
ccccacgaaggaccagaacaagacagagtgcctcccgccaatccaaacatgagcctcctg
cccgtcctgctcctgctccatctcctggtcagccccggactccaagctcccatgacccag
acaacgtccttaaagataagctgggctaactgctctaacatgatcgatgaaattataaca
cacttaaaccagccacctttgccttcgctggacttcaacaacctcaatggggaagaccga
gccattctggtggaaaaaaaccttcgaaggtcaaacctggaggcattcagtaaggctgtc
aagagtttacagaacgcatcagcaatcgagagcattcttaagaatctcccaccatgcctg
cccatggccacggccgcacccacgcgacctccaatccgtatcacgaacggtgaccggaat
gacttccggaggaaactgaagttctatctgaaaacccttgagaatgagcaggctcaatag

DBGET integrated database retrieval system