KEGG   Camelina sativa (false flax): 104730905Help
Entry
104730905         CDS       T05044                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP53
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:csat03009]
    104730905
Enzymes [BR:csat01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     104730905
Ribosome biogenesis [BR:csat03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    104730905
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C NPL Utp14
Motif
Other DBs
NCBI-GeneID: 104730905
NCBI-ProteinID: XP_010448446
LinkDB All DBs
Position
12
AA seq 469 aa AA seqDB search
MGFWGLEVKPGKPQTYNPKNEQGKIHVTQATLGSGFAKEKSVIQCSIGDKAPVFLCSLLP
NKIECCSLNLEFDDDDEPIEFSVTGDRSIHLSGFLEYYDEDEDEDDYEEDEDDVSDGVEI
GESESDDSCEYDSEEEDQLDQFEDFLDTNLEMYRNASVPKSGVVIEEIEDEEKPAKDSKT
KRTKKSQASEAANAKKQIVPVESAHVPVLESEDEDEDGLPIPKGEASEPENKSGEKMDLD
NEEQGSNKKRKAKAAEQDGGLESGNKSKKKKNQKEKKKGESASKEEADEQVKTGNVLKKQ
ETSQVSQGESSQTPTKSAEKKNKKKKNSSQEATVENNTISSSAEKQTQVDSKSSQVRTHP
NGLKIEELSMGKPNGKRADPGKQVFVRYIGKLQKNGKIFDSNIGKSPFKFRLGVGQVIKG
WDVGVNGMRVGDKRRLTIPPSMGYGTQGAGPQIPPNAWLSFEVELVNVQ
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgggtttctggggacttgaagtgaaacctgggaaacctcaaacttacaatcccaaaaac
gaacaaggaaagattcacgtcacacaggcaacactaggctctggttttgccaaagagaag
agtgtgattcagtgttccataggagacaaggctcctgttttcttgtgttcattgttgcca
aacaaaattgaatgctgctctctgaatctcgagtttgacgatgatgatgagcctatcgag
ttctctgtgactggtgacagaagtatccacctgtctggattcttggagtattatgatgag
gatgaggatgaagatgattatgaggaggatgaagatgatgtttcagatggtgttgaaatc
ggtgaatctgagtcggacgattcatgtgaatatgatagtgaagaggaggatcagttggat
caatttgaagacttccttgataccaatcttgaaatgtatcggaatgcttctgtcccaaag
agtggagttgtaattgaggagatagaagatgaagagaaacctgccaaagatagtaagaca
aaacgaaccaagaagagtcaagctagcgaagctgcgaatgcaaagaaacaaatcgtccct
gttgagagtgcccatgttccagttctggaaagcgaggatgaggatgaagacggtttacct
attcccaagggagaagcatctgaaccagagaataagtcgggtgagaagatggacttagat
aatgaagaacaaggtagcaacaagaaaaggaaggccaaggctgctgagcaagatggtgga
ctagaaagtggaaacaagagcaaaaagaagaagaatcagaaagaaaagaagaaaggggaa
agtgcctcaaaagaggaagctgatgaacaagttaagactggaaatgtgctcaaaaagcag
gaaacaagccaagtttctcagggtgaaagctcccagaccccaactaaatctgctgagaag
aaaaacaagaagaaaaagaactcaagtcaggaagctactgtggagaataataccatttct
agtagtgctgagaagcaaacccaagtggactccaagtcttctcaagtacggacacatcca
aatgggctcaaaattgaagagttgagcatgggcaagcccaacggcaagagagctgatcct
ggaaaacaggtttttgtccgctatattggaaagcttcaaaagaatgggaagatatttgat
tccaacattggaaaatcaccttttaagttccgtctaggtgttggacaagtcattaaggga
tgggatgttggcgttaacggcatgcgtgttggtgacaaaagaaggcttacaattcctcca
tcaatggggtatggtacgcagggtgctggtccccagattcctcctaacgcttggctgtcg
tttgaagtcgaactagttaatgttcaataa

DBGET integrated database retrieval system