Camelina sativa (false flax): 104775071 Help Entry 104775071         CDS       T05044                                  Name (RefSeq) calmodulin-1-like   KO K02183   calmodulin Organism csat  Camelina sativa (false flax) Pathway csat04016   MAPK signaling pathway - plant csat04070   Phosphatidylinositol signaling system csat04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:csat00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     104775071    04070 Phosphatidylinositol signaling system     104775071  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     104775071  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:csat01009]     104775071   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:csat04131]     104775071    03036 Chromosome and associated proteins [BR:csat03036]     104775071   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csat04147]     104775071 Protein phosphatases and associated proteins [BR:csat01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104775071 Membrane trafficking [BR:csat04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     104775071 Chromosome and associated proteins [BR:csat03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      104775071 Exosome [BR:csat04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104775071 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EF-hand_4 DUF5580_M SPARC_Ca_bdg EF-hand_11 EFhand_Ca_insen UPF0154 Dockerin_1 Poly_export DUF1103 PA_Ig-like MotA_activ SurA_N_2 RNA_pol_Rpb4 Motif Other DBs NCBI-GeneID:  104775071 NCBI-ProteinID:  XP_010497669 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKD QNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVDGDGQINYEEFVKIMMAK NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgcgttcactaggacagaacccaacagaggctgagctccaagacatgatcaacgaggtt gatgcagatggaaacggcaccatcgactttcccgagtttctgaacctgatggctaagaag atgaaagacactgactcagaggaagaactaaaagaagcattcagagttttcgacaaggac cagaacggtttcatctccgctgctgagctacgccatgtgatgaccaatcttggggagaag ctaactgatgaagaagttgaagagatgatccgtgaggctgatgttgatggagatggtcag attaactatgaggagttcgtcaagattatgatggctaagtga

DBGET integrated database retrieval system