KEGG   Caulobacter segnis: Cseg_2777Help
Entry
Cseg_2777         CDS       T01221                                 

Definition
(GenBank) protein of unknown function DUF205
  KO
K08591  acyl phosphate:glycerol-3-phosphate acyltransferase [EC:2.3.1.275]
Organism
cse  Caulobacter segnis
Pathway
cse00561  Glycerolipid metabolism
cse00564  Glycerophospholipid metabolism
cse01100  Metabolic pathways
cse01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cse00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Cseg_2777
   00564 Glycerophospholipid metabolism
    Cseg_2777
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cse01004]
    Cseg_2777
Enzymes [BR:cse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.275  acyl phosphate:glycerol-3-phosphate acyltransferase
     Cseg_2777
Lipid biosynthesis proteins [BR:cse01004]
 Phospholipid acyltransferase
  GPAT
   Cseg_2777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G3P_acyltransf
Motif
Other DBs
NCBI-ProteinID: ADG11225
UniProt: D5VL52
LinkDB All DBs
Position
3039334..3039984
Genome map
AA seq 216 aa AA seqDB search
MESLASAVYLTLAIAVVGGYLLGSIPFGLIATRLGGAGDIRQIGSGNIGATNVLRSGRKD
LALITLLGDAGKGVVAVLLARYLTHGNPMVIALAGGAAFLGHLFPVWLKFKGGKGVATFY
GVLLSAAWPVGALAAITWLAMAAIFRISSLAALTAAVLAAPFAIATDQPRPILGLAIFMA
ILIFIRHRENIARLLKGEEPKIGKKKPAEPAPAEAP
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
gtggaaagtctcgcctctgccgtttatctgactctcgcgatcgccgtcgtcggcggctat
ctgctgggatcgattccgttcggcctcatcgccacgcgtcttggcggcgcgggcgacatc
cgccagatcggttcgggcaatatcggcgcgaccaacgtgctgcgctccgggcgcaaggat
ctggccctcatcaccctgctgggcgacgccggcaagggcgtggtggcggtgctgctggcc
cgttacctgacccacggaaatcccatggtgatcgccctggccggcggcgcggcgtttctg
ggccacctgttcccggtgtggctgaagttcaagggcggcaagggcgtggccaccttctac
ggcgtgctgctcagcgcggcctggccggtgggcgcgctcgcggccatcacctggctggcc
atggccgccatcttccggatcagctcgctggccgccctgaccgccgccgtcctggccgcc
cccttcgccatcgccaccgaccagccgcgcccgatcctgggcctggcgatcttcatggcc
atcctgatcttcatccgtcaccgcgagaacatcgcgcgcctgctcaagggcgaggagccg
aagatcggcaagaagaagccggccgagccggcgcccgccgaggcgccgtga

DBGET integrated database retrieval system