KEGG   Cynoglossus semilaevis (tongue sole): 103377652
Entry
103377652         CDS       T04866                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
csem04261  Adrenergic signaling in cardiomyocytes
csem04370  VEGF signaling pathway
csem04371  Apelin signaling pathway
csem04510  Focal adhesion
csem04620  Toll-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04910  Insulin signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem04920  Adipocytokine signaling pathway
csem05132  Salmonella infection
csem05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103377652
   04012 ErbB signaling pathway
    103377652
   04370 VEGF signaling pathway
    103377652
   04371 Apelin signaling pathway
    103377652
   04068 FoxO signaling pathway
    103377652
   04150 mTOR signaling pathway
    103377652
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103377652
  09143 Cell growth and death
   04210 Apoptosis
    103377652
   04218 Cellular senescence
    103377652
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103377652
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103377652
   04625 C-type lectin receptor signaling pathway
    103377652
  09152 Endocrine system
   04910 Insulin signaling pathway
    103377652
   04920 Adipocytokine signaling pathway
    103377652
   04914 Progesterone-mediated oocyte maturation
    103377652
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103377652
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103377652
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103377652
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103377652
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103377652
Protein kinases [BR:csem01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   103377652
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 103377652
NCBI-ProteinID: XP_008306748
UniProt: A0A3P8UV66
LinkDB
Position
4
AA seq 482 aa
MNEVSVVREGWLHKRGEYIKTWRPRYFILKSDGSFIGYKEKPEVSSDHSLPPLNNFSVAE
CQLMKTERPRPNTFVIRCLQWTSVIERTFHVDSSEEREEWMRSIQTVANSLKSQQQDEEP
MEIKFGSPSDNSGTEEMEIAVSKSHTKVTMSDFDYLKLLGKGTFGKVILVKEKATGMYYA
MKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFF
HLSRDRVFTEDRARFYGAEIVSALEYLHSRNVVYRDLKLENLMLDKDGHIKITDFGLCKE
GITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLF
ELILMEEIRFPKNLAPDAKALLAGLLKKDPKQRLGGGADDAKEVMSHKFFASINWQDVTE
KKLVPPFKPQVTSETDTRYFDDEFTAQTITITPPDKYDSLDGEDSDQRTHFPQFSYSASI
RE
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgaatgaagtgagtgtcgtgagagagggatggctccacaagagaggtgaatacattaaa
acctggcggcctcgttacttcatcctaaagagcgatggctccttcattggctacaaggag
aagcctgaggtgtccagcgaccacagccttccaccactcaacaatttctctgtcgcggag
tgtcagttgatgaagacggagcgtcccaggcccaacacgttcgtcatccgctgcctccag
tggacctcggttatcgagcgcacttttcacgtggacagcagcgaggaaagggaggaatgg
atgcgatcgatccagacggtggcaaacagcctgaagagtcagcagcaggacgaggagccc
atggagatcaaatttggctccccgagcgacaacagtggcacagaggagatggagatcgcc
gtgtccaaatctcacacaaaagtgaccatgagcgactttgactacctgaagctgctcggc
aaagggacgtttggcaaagtcatcctggtaaaggagaaggccacggggatgtactacgca
atgaaaatcctccgtaaagaagtcatcatcgctaaagacgaggtggcacacaccgtcaca
gagagcagagttctccaaaacacccggcacccgtttctaacaacactaaagtatgcattt
caaacacacgaccgcctctgcttcgtcatggagtatgcaaacggaggagagctcttcttt
cacttatcacgggaccgagtgtttacagaagacagagcgcgattctacggtgcagaaata
gtgtcagcactggagtacttacactcccgcaacgttgtttacagggatttgaagctggag
aacctcatgttagacaaggacggccacataaagatcacagactttggattatgtaaagag
ggaatcacagatggcgccaccatgaagaccttctgtggaaccccagagtacctggcaccg
gaggtgttggaggacaatgattacggccgagcagtggactggtgggggctgggcgtggtc
atgtatgaaatgatgtgtggccggttgcccttctacaaccaggaccacgagcgtctcttc
gagctcatcctcatggaggaaatccggttccccaagaacctagctcctgacgctaaggcc
ctgttagccggcctgctcaaaaaggaccctaaacagcggctcgggggtggagcagacgac
gccaaagaagtgatgagccacaagtttttcgcgtccatcaactggcaggatgtgactgag
aaaaagctcgttccgccctttaagccccaggtcacgtcggagacggacacgcggtacttt
gacgatgagttcacagcacaaaccatcacgataacgccaccggataagtatgacagttta
gacggagaggactccgatcagcgcacgcacttcccgcagttctcttactctgccagcata
cgggaatga

KEGG   Cynoglossus semilaevis (tongue sole): 103383890
Entry
103383890         CDS       T04866                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: RAC-gamma serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
csem04261  Adrenergic signaling in cardiomyocytes
csem04370  VEGF signaling pathway
csem04371  Apelin signaling pathway
csem04510  Focal adhesion
csem04620  Toll-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04910  Insulin signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem04920  Adipocytokine signaling pathway
csem05132  Salmonella infection
csem05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103383890
   04012 ErbB signaling pathway
    103383890
   04370 VEGF signaling pathway
    103383890
   04371 Apelin signaling pathway
    103383890
   04068 FoxO signaling pathway
    103383890
   04150 mTOR signaling pathway
    103383890
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103383890
  09143 Cell growth and death
   04210 Apoptosis
    103383890
   04218 Cellular senescence
    103383890
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103383890
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103383890
   04625 C-type lectin receptor signaling pathway
    103383890
  09152 Endocrine system
   04910 Insulin signaling pathway
    103383890
   04920 Adipocytokine signaling pathway
    103383890
   04914 Progesterone-mediated oocyte maturation
    103383890
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103383890
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103383890
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103383890
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103383890
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103383890
Protein kinases [BR:csem01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   103383890
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C PH
Other DBs
NCBI-GeneID: 103383890
NCBI-ProteinID: XP_008315436
LinkDB
Position
9
AA seq 471 aa
MSDQNVVKEGWVQKRGEYIKNWRPRXXXXXXXXXXDKPQDSDLAYPLNNFSVAKCQLMKT
ERPKPNTFIIRCLQWTTVIERTFHVDTPEERDQWVEAIQMVAESLAKQEEEGILCSPTSQ
IENVNEEEMDTSISHYKRKTMNDFDYLKLLGKGTFGKVILVREKASGTYYAMKILKKEVI
IAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSXXXXXX
XXXXAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDTATMKTFCG
TPEYLAPEVLEDNDYGRAVDWWGLGVVTYEMMCGRLPFYNQDHEKLFELILMEEIKFPRT
LSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSTVDWQDVYDKKLAPPFQPQVSS
ETDTRYFDEEFTAQTITITPPEKFDEDGMDAADNERRPHFPQFSYSASGRE
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgagtgaccagaacgtagtgaaggaaggctgggtgcagaagcgaggtgagtacattaag
aactggcgaccgcgcnnnnnnnnnnnnnnnnnnnnnnnnnnnnaggacaaaccacaggat
tcagacctggcctatccactcaacaacttctctgtagcaaaatgtcagctgatgaaaaca
gaacgtcctaaaccaaacaccttcatcatccgctgccttcaatggaccactgtcattgag
agaaccttccacgtagacactcctgaggagagggaccaatgggtggaagccatccagatg
gtggcagagtctctggccaaacaggaggaggaaggaatcttgtgcagccctacctcccag
atagagaacgtcaacgaagaggagatggacacctccatcagccactacaaacgaaagact
atgaacgactttgactacctgaagcttctgggtaaaggcacctttggaaaagtcatcctg
gtgagggagaaggccagtggaacctactacgccatgaagattctgaagaaggaagtcatc
atagccaaggatgaagtggctcacacactgacagaaagccgggtgttaaaaaacactcgg
cacccattcctcacttccctcaagtactcgttccaaaccaaggaccggctctgctttgtc
atggagtacgtcaacggaggagagctgtttttccatttgtcacnnnnnnnnnnnnnnnnn
nnnnnnnnnnnngctgaaattgtctctgctctcgactacctgcattcagctaaaattgtc
taccgtgacctgaagctggagaacctgatgttggacaaagatggacacatcaagatcaca
gactttggtctgtgtaaagagggcatcactgacacagccactatgaagactttctgtgga
actccagagtacctggctcctgaggtcctggaggacaatgactacggacgggcagtggac
tggtggggtctgggcgtggtgacgtacgagatgatgtgcggccgactgcccttctacaac
caggaccacgagaagctgtttgagctcatcctcatggaggagatcaagtttcctcggact
ctgagtgctgatgcaaagtccctgctgtcagggctgctcatcaaagaccccaacaaacga
ttgggaggtggaccagatgatgccaaggagatcatgagacacagtttcttcagcactgtg
gactggcaggacgtctacgacaagaagctggccccgccctttcagccgcaggtgtcatca
gagacagacacgcgctactttgacgaggagtttacagcacagaccatcaccatcaccccg
cctgaaaaattcgatgaagatgggatggatgcagcagacaacgaacgacggcctcatttc
ccacagttctcgtactcggccagtggacgggagtga

KEGG   Cynoglossus semilaevis (tongue sole): 103387066
Entry
103387066         CDS       T04866                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase-like isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
csem04261  Adrenergic signaling in cardiomyocytes
csem04370  VEGF signaling pathway
csem04371  Apelin signaling pathway
csem04510  Focal adhesion
csem04620  Toll-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04910  Insulin signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem04920  Adipocytokine signaling pathway
csem05132  Salmonella infection
csem05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103387066
   04012 ErbB signaling pathway
    103387066
   04370 VEGF signaling pathway
    103387066
   04371 Apelin signaling pathway
    103387066
   04068 FoxO signaling pathway
    103387066
   04150 mTOR signaling pathway
    103387066
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103387066
  09143 Cell growth and death
   04210 Apoptosis
    103387066
   04218 Cellular senescence
    103387066
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103387066
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103387066
   04625 C-type lectin receptor signaling pathway
    103387066
  09152 Endocrine system
   04910 Insulin signaling pathway
    103387066
   04920 Adipocytokine signaling pathway
    103387066
   04914 Progesterone-mediated oocyte maturation
    103387066
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103387066
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103387066
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103387066
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103387066
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103387066
Protein kinases [BR:csem01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   103387066
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 103387066
NCBI-ProteinID: XP_008319782
LinkDB
Position
12
AA seq 487 aa
MSDVTIVREGWLQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDSPDERDEWTEAIQTVADRLQRQEEERIQRS
PTSNIDNLVEEEMDISTTHHKRKTMSDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEERTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDT
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVTYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVDWQNVYEKKVPQ
QSSLWIRALVPPFKPQVMSETDTRYFDEEFTAQTITITPPEKCESVSLQHENKFLNKSPK
KTFLKND
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgagcgatgtcaccatcgtcagagagggatggctccagaaacggggtgaatacataaag
aactggagaccacggtacttcctgttgaagacagacggctccttcatcggctacaaagag
aaacctcaggatgcagatctgccgtaccctctcaacaacttctctgtagcaaaatgtcag
ctgatgaagacggagaggccgaagccaaacaccttcatcatacgctgcctccagtggacc
acggtcatcgagagaaccttccacgtggactcacctgacgagagagatgagtggacggag
gccattcagacggtggcggaccggctgcagagacaggaggaggagaggatccaacgcagc
cccacctccaacatcgacaacctggtggaggaggaaatggacatctccaccacacaccac
aaacgaaagacgatgagcgacttcgactacctgaagctgctgggaaaaggcacctttgga
aaagtcatcctggtccgggaaaaggccagcggcaaatattacgccatgaaaatcctcaaa
aaagaagtcatcatcgccaaggatgaagtggctcacacactgacggagagcagagtcctg
aaaaacaccagacacccttttctcacttccttgaagtattccttccagactaaagacaga
ctgtgttttgtcatggagtatgtgaacggaggagagctgttcttccatttgtccagagag
cgggtgttctcagaggagcgcacgcgcttctacggcgccgagatcgtctctgctctcgac
tacctgcactcagccaagattgtgtaccgggacctgaagttagaaaacctgatgctggac
aaagacggccacatcaagatcacagattttggcctgtgtaaggagggaatcaccgacacg
gccaccatgaagaccttctgtgggaccccggagtacctggctcctgaggtcctggaggac
aacgactacggtcgggcggtggactggtggggtctgggtgtggtgacctatgagatgatg
tgtggccggttgccgttctacaaccaggaccatgagaagctgtttgagctcatcctgatg
gaggacatcaagttcccgcgcactctgtctgcagacgccaagtcgctgctgtccggtctg
ctcatcaaagaccccaacaaacgcctgggtggaggaccagacgacgctaaagaaatcatg
agacacagtttcttctctggtgtggactggcagaacgtctatgagaagaaggtaccacag
cagagcagtctctggatcagagcactggtccctcccttcaagcctcaggtgatgtcagag
acagacaccagatactttgatgaggagttcacagcccagacaatcaccatcactccacca
gagaaatgtgagtctgtgtcacttcaacatgaaaacaagttcctgaacaaatctccgaaa
aaaacgtttctcaaaaatgactaa

KEGG   Cynoglossus semilaevis (tongue sole): 103388143
Entry
103388143         CDS       T04866                                 

Gene name
akt1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
csem04261  Adrenergic signaling in cardiomyocytes
csem04370  VEGF signaling pathway
csem04371  Apelin signaling pathway
csem04510  Focal adhesion
csem04620  Toll-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04910  Insulin signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem04920  Adipocytokine signaling pathway
csem05132  Salmonella infection
csem05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103388143 (akt1)
   04012 ErbB signaling pathway
    103388143 (akt1)
   04370 VEGF signaling pathway
    103388143 (akt1)
   04371 Apelin signaling pathway
    103388143 (akt1)
   04068 FoxO signaling pathway
    103388143 (akt1)
   04150 mTOR signaling pathway
    103388143 (akt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103388143 (akt1)
  09143 Cell growth and death
   04210 Apoptosis
    103388143 (akt1)
   04218 Cellular senescence
    103388143 (akt1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103388143 (akt1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103388143 (akt1)
   04625 C-type lectin receptor signaling pathway
    103388143 (akt1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103388143 (akt1)
   04920 Adipocytokine signaling pathway
    103388143 (akt1)
   04914 Progesterone-mediated oocyte maturation
    103388143 (akt1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103388143 (akt1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103388143 (akt1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103388143 (akt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103388143 (akt1)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103388143 (akt1)
Protein kinases [BR:csem01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   103388143 (akt1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11 Pkinase_fungal Seadorna_VP7
Other DBs
NCBI-GeneID: 103388143
NCBI-ProteinID: XP_008321285
LinkDB
Position
1
AA seq 474 aa
MTNVVIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQAVAEGLQKQEEEMMDS
SPDPMDMEVYLTKPRHKVTMHDFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIV
AKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFSE
ERARFYGAEIVSALDYLHAERNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMK
TFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIR
FPRTLGLEARSLLSGLLKKDPMQRLGGGPDDAKEIMQHKFFAGIEWQDVYMKKLVPPFKP
QATSETDTRYFDEEFTAQTITITPPGQADDSMESFDSERRPHFPQFSYSASGTA
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgaccaatgtggtgatcgtcaaggagggatggctgcataaaagaggagaatacatcaaa
acctggaggccgaggtatttcctcctgaagagtgatggtacattcattggctacaaagag
cgaccacaagatgtcgaccagctggagactcctctgaataacttctctgttgcacagtgc
cagctgatgaagacggaacggcccaggcccaacacatttatcatccgctgcctgcagtgg
accactgtcatcgagcgcaccttccacgtggagacccctgaggagagggaagaatggacc
aaagccatccaggctgtggccgagggtctgcagaaacaagaggaggagatgatggactcc
tctccagacccgatggacatggaggtctaccttaccaaacccaggcacaaagtgactatg
cacgactttgaatacctcaaactcctgggaaaaggcacttttggcaaagttatcctggta
aaggagaaggccacgggacgctactacgccatgaagatcctgaagaaggaagtgatcgta
gcaaaagatgaagtggcgcacacactcacagagaaccgagtcctccagaattcaaagcat
ccgttcctgacaggactgaagtactctttccagactcacgaccgcttgtgttttgtcatg
gaatatgcaaacggcggtgagcttttcttccatctttcaagagaccgcgtgttctcggag
gagcgggcgcgtttctacggtgcagagatagtgtcggcgctggactacctgcatgctgaa
agaaatgtggtctatcgagatctgaagctggaaaacctgatgctggacaaagacggacac
ataaagatcacagacttcggcctgtgtaaggaggggatcaaagacggtgccaccatgaag
accttctgtgggacgccggagtacctggcacccgaggtgctagaagacaacgactacggc
cgtgcggtggattggtggggtctgggcgtagtcatgtatgagatgatgtgcggccgactt
ccgttctacaaccaggaccacgagaagctgtttgagctcattctcatggaggacatccgt
ttcccccggacacttggtctcgaagcgcgctcacttctctctggccttctcaaaaaagac
ccgatgcagaggttaggcggaggtcctgacgacgccaaggaaatcatgcagcacaagttt
tttgcaggaatcgaatggcaggacgtttatatgaagaagttggttccaccgtttaaacca
caagctacctctgaaactgacacgagatattttgatgaggagttcacagcacagaccatc
accatcacaccacctggtcaagcagatgacagtatggagtccttcgacagcgagcgaaga
cctcacttcccgcagttctcctactccgccagtgggacggcctag

KEGG   Cynoglossus semilaevis (tongue sole): 103395035
Entry
103395035         CDS       T04866                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
csem04261  Adrenergic signaling in cardiomyocytes
csem04370  VEGF signaling pathway
csem04371  Apelin signaling pathway
csem04510  Focal adhesion
csem04620  Toll-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04910  Insulin signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem04920  Adipocytokine signaling pathway
csem05132  Salmonella infection
csem05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103395035
   04012 ErbB signaling pathway
    103395035
   04370 VEGF signaling pathway
    103395035
   04371 Apelin signaling pathway
    103395035
   04068 FoxO signaling pathway
    103395035
   04150 mTOR signaling pathway
    103395035
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103395035
  09143 Cell growth and death
   04210 Apoptosis
    103395035
   04218 Cellular senescence
    103395035
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103395035
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103395035
   04625 C-type lectin receptor signaling pathway
    103395035
  09152 Endocrine system
   04910 Insulin signaling pathway
    103395035
   04920 Adipocytokine signaling pathway
    103395035
   04914 Progesterone-mediated oocyte maturation
    103395035
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103395035
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103395035
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103395035
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103395035
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103395035
Protein kinases [BR:csem01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   103395035
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11
Other DBs
NCBI-GeneID: 103395035
NCBI-ProteinID: XP_008330793
UniProt: A0A3P8WWB4
LinkDB
Position
19
AA seq 480 aa
MNEVNVVKEGWLQKRGEYIKTWRARYFILKSDGSFIGNKEKPDLNDQTSPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSNEEREEWMRAIQSVANSLKMREQEDEEP
MDVFGSPSESSLEEMEVAMSKSRNKVTMSDFEYLKLLGKGTFGKVILVKEKSTGVHYAMK
ILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTNDRLCFVMEYANGGELFFHL
SRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
TPDATMKTFCGTPEYLAPEVLEDNDYGRSVDWWGLGVVMYEMMCGRLPFYNQDHERLFEL
ILMEEIRFPRNLSPEAKSLLAGLLKKDPKQRLGGGPNDAKEVMSHKFFVDIIWQDVVQKK
LTPLFRPQVTSETDTRYFDEEFTAQTITLTPPDKYTSLDCEDPTQQAHFPQFSYSASIRE
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaatgaagttaatgtagtcaaagagggctggctccagaaaagaggtgagtacattaaa
acatggagggcccggtatttcatcctgaagagtgacggctccttcatcggcaacaaggag
aagcctgatcttaacgaccagacttcaccacctctcaacaacttctctgtggcagaatgc
cagctaatgaagacagaaagaccccggcccaacacctttgtcatccgttgccttcagtgg
accactgttattgaacgtacctttcacgtggacagcaatgaggaaagagaagagtggatg
cgcgctatccagtcggtggctaacagtctgaagatgcgagaacaggaggacgaagaacca
atggatgtgtttggttcacccagtgaaagcagcttggaggaaatggaggtggccatgtcc
aagagtcgcaacaaagtgacaatgagcgactttgagtacctgaagctgctgggtaagggc
acatttggaaaggtgattcttgtcaaagagaagtccactggagttcattatgccatgaaa
atactgcgcaaagaggtcattattgccaaggatgaggtggctcacacagtaacagagagc
agagttttacaaaacacgcgacaccccttcctcacgacactcaagtacgctttccaaacc
aatgaccggctctgttttgtaatggagtatgccaacggaggcgagcttttcttccatctg
tcacgggagcgggttttcacagaagaccgggcacgcttctacggggcggagattgtgtcg
gctctggagtacctgcattcacgagacgtcgtttaccgggatctgaagctggaaaatctg
atgttggacaaagacggtcacatcaagatcaccgactttggcctttgtaaggagggcatc
actcctgacgcaaccatgaaaaccttctgtggaactcctgaatacctggcacctgaggtc
ctagaagacaatgactacggccgttcagtagactggtggggtctgggtgtggtcatgtat
gagatgatgtgtggacgtctgcccttctacaaccaagaccatgagcgcttgtttgagctc
atcctcatggaggagatccgtttccctaggaacctgtcgcctgaggccaagtccctgctg
gctggcctgctgaagaaagaccccaaacagaggttaggcggaggacccaatgatgccaaa
gaagtaatgagtcacaagtttttcgtcgacatcatctggcaggatgtggtacagaagaag
ctcaccccactcttcagaccacaagtgacatcggagacagacacccggtactttgatgaa
gagttcacggcgcagaccatcacgctcactcctccagataaatataccagtctggactgt
gaggatcccacgcagcaagcacatttcccccagttctcttactctgccagcattagagag
tga

DBGET integrated database retrieval system