KEGG   Cynoglossus semilaevis (tongue sole): 103377708
Entry
103377708         CDS       T04866                                 

Gene name
nlk
Definition
(RefSeq) serine/threonine-protein kinase NLK
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04068  FoxO signaling pathway
csem04310  Wnt signaling pathway
csem04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103377708 (nlk)
   04310 Wnt signaling pathway
    103377708 (nlk)
   04068 FoxO signaling pathway
    103377708 (nlk)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103377708 (nlk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103377708 (nlk)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103377708 (nlk)
Protein kinases [BR:csem01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103377708 (nlk)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like FTA2
Other DBs
NCBI-GeneID: 103377708
NCBI-ProteinID: XP_008306836
UniProt: A0A3P8UVM5
LinkDB
Position
4
AA seq 551 aa
MALCSTAAANVPKMMAAYNGGSSAVAAHHPHPHHHQLQHLPAPHMHHHHHPGQHHLQHPG
SAAAVAAAAVHTDQQQQQHASTAAAAAAAAAAAVMLNPGQQQPYFPSPAPGQAPGPAAAA
APAQVQAAAAVKAHHHHHHHHHHQQQQHQHQHGHHLQQQLDIEPDRPIGYGAFGVVWSVT
DPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHENVLSALDILQPPHIDYFEEIY
VVTELMQSDLHKIIVSPQPLSSDHAKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNC
VLKICDFGLARVEESDESRHMTQEVVTQYYRAPEILMGSRHYHNSIDIWSVGCIFAELLG
RRILFQAQSPIQQLDLITDLLGTPSMEAMRTACEGARAHILRGPHKQPCLPVLYTLSSQA
THEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCYTTSSGRVYTSDFE
PITNLKFDDGFEKNLSSVRQVKEIIHQFILEQQKGSRVPLCINPQSAAFKSFISSTVAQP
SEMPPSPLVWE
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggctctttgcagcacggcggctgcaaatgttccaaaaatgatggctgcttacaatggt
ggctcctctgctgtggctgcccatcacccgcatccgcaccaccaccagctccagcacctc
ccagccccacacatgcaccaccatcaccaccctggccagcatcacctacagcacccgggt
tctgctgccgctgtcgccgccgccgccgtgcacactgaccagcagcagcagcagcacgcc
tccactgccgccgcagccgctgccgccgcagccgcagcggtgatgctcaacccaggtcag
cagcagccttactttccctccccagcaccaggacaagctcctgggccagcagcggccgcc
gctccagcgcaggtccaagccgcggcggctgtcaaagcccatcaccatcatcatcaccat
catcaccaccagcagcagcaacatcagcatcaacatggccaccacctgcagcagcagctg
gacatcgagccggaccggcccattggctacggcgcgtttggagttgtgtggtcagtgaca
gaccccagagatggaaaacgagtcgccctcaaaaagatgcccaatgtcttccaaaacctc
gtgtcttgtaagagggtgtttcgggagttgaagatgctgtgtttcttcaagcatgaaaat
gttctctccgctctggacatacttcaacctccacacatcgactacttcgaggaaatctac
gtggtgacagaactgatgcaaagtgaccttcataagatcatcgtttctccacagcctctg
agctcagatcatgccaaagtctttctgtatcagattctaagaggactgaaataccttcat
tctgctggcattctacaccgagacatcaaacctggcaaccttctggttaacagcaactgc
gtgctcaagatctgtgacttcggactcgcccgagtggaggagtccgacgagtcacgccac
atgactcaggaagtcgtaacccagtactaccgagctccagagatcctgatggggagccgt
cactaccacaactccatcgatatctggtctgtgggctgcatctttgctgagctgctgggc
agacggatcctctttcaggcccaaagtccaatccagcagctggacttgatcactgacctt
ctggggactccgtccatggaggccatgaggacggcgtgtgaaggggctcgtgctcacatt
ctcagaggacctcacaaacagccatgccttcctgttctctacacactttccagccaagcc
acccacgaagctgtccatcttctctgcaggatgctggtctttgatccttcaaagagaatc
tcagctaaggacgctctggctcacccctacctggacgagggtcgactgcgctaccacacg
tgcatgtgcaagtgctgctacaccacctcctcgggccgcgtgtacaccagtgactttgag
cccatcactaatctcaagtttgatgacggcttcgagaagaacctgagctctgtcagacag
gtcaaagagatcatccatcagttcattctggagcagcagaaagggagtcgagtgccgctc
tgcatcaacccccagtctgctgcttttaaaagctttatcagctccacagtggctcagccg
tctgaaatgcctccgtctccgctggtgtgggaatag

KEGG   Cynoglossus semilaevis (tongue sole): 103393459
Entry
103393459         CDS       T04866                                 

Definition
(RefSeq) serine/threonine-protein kinase NLK2-like
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04068  FoxO signaling pathway
csem04310  Wnt signaling pathway
csem04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103393459
   04310 Wnt signaling pathway
    103393459
   04068 FoxO signaling pathway
    103393459
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103393459
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103393459
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103393459
Protein kinases [BR:csem01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103393459
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH FTA2
Other DBs
NCBI-GeneID: 103393459
NCBI-ProteinID: XP_008328652
LinkDB
Position
17
AA seq 475 aa
MAFHGTGRQNVCGDLFPGSDLSHKYFCVNSSCGAPSTGLSATPCLTGPNAPAGTPRHPTA
LGGSAGGGAAVPQPYTNPASEVPSPAEMEPDRPIGYGAFGVVWSVTDPRDGRKVALKKMP
NVFQNLVSCKRVFRELRMLCFFKHDNVLSALDILQPPQIDCFEEIYVITELMQSDLHKVI
VSPQPLTTDHIKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCLLKICDFGLARVEE
PDPSRHMTQEVVTQYYRAPEVLMGCRHYGSAIDVWSVGCIFAELLGRRILFQAQSPIQQL
DLITDLLGTPPLSALASACEGARAHILRGPHKPVSLSVLYMLSDGATHEAVHLLCRMLVF
DPTKRISGSDALSHPYLDEGRLRYHTCMCQCCYSVPSGRVYTRDFEPAAERPFSHSYESS
LLSVWQGKELIHRFITEHQQGKRVPLCINPQSAAFKTFIRSTAWHSSKVSKKEER
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcgtttcacggcacgggtcgacagaacgtctgtggagatctgtttcctggctctgac
ctcagtcacaagtatttctgcgtcaactcctcctgcggcgctccctccacaggcctcagc
gccactccgtgtctgactggacccaacgctccggctgggaccccccgtcaccctacagct
cttggaggaagtgcgggaggtggagcagcggtgcctcagccttacactaaccctgccagt
gaggttcccagcccggcagagatggagccagaccggcccattggctacggcgcgtttggt
gtcgtctggtcagtgaccgacccccgagatggtcgaaaggtggctctgaagaagatgccc
aatgtcttccagaacctggtctcctgtaagagggtcttcagagaactgcgcatgctctgc
ttcttcaaacacgacaacgttttatcagcgctggacattttacagcctccacagatagac
tgcttcgaggaaatctacgtgatcacagagttgatgcagagcgacctccataaggtcatc
gtgtcccctcagcccctcaccacagaccacatcaaggtcttcctctaccagatcctcaga
ggtctgaagtaccttcactctgctgggatcctgcacagagacatcaaacctggaaacctg
ctggtcaacagcaactgtctgctgaagatctgtgacttcgggctggcgcgcgtggaggag
cctgacccgtcacgtcacatgacccaggaggtggtgacccagtactaccgagcgcccgag
gtactgatgggttgccggcactacggctcggccatcgacgtctggtcagtgggctgcatc
tttgcagagctgctgggaagacgtatcctgttccaggctcagagtccaattcagcagctg
gacctgatcacagacctgctgggaactccgcccctctccgccttggcctccgcctgtgaa
ggagcacgagcccacatactcagggggcctcacaaaccggtatccctgtcggttctctac
atgctgtctgacggggccacgcacgaagccgtgcacctgctctgtcgaatgctggtcttt
gatccgaccaagaggatttcaggcagcgacgctctctctcacccgtacctggacgaaggg
cgtctgcgttaccacacctgcatgtgtcagtgctgttactcagtgcccagtgggcgggtc
tacacccgagactttgagccagctgccgagagaccgttcagccacagctacgagagcagt
ctactgtcagtgtggcagggaaaagagctgatccaccgcttcatcacagagcaccagcag
ggcaaacgtgtgccgctctgcatcaaccctcagagcgccgccttcaagaccttcatcagg
tcaacagcgtggcattcatccaaggtttccaagaaggaggaaagatga

DBGET integrated database retrieval system