KEGG   Cynoglossus semilaevis (tongue sole): 103390448Help
Entry
103390448         CDS       T04866                                 

Definition
(RefSeq) prostaglandin G/H synthase 1 isoform X1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00590  Arachidonic acid metabolism
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103390448
Enzymes [BR:csem01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103390448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 103390448
NCBI-ProteinID: XP_008324532
LinkDB All DBs
Position
14
AA seq 605 aa AA seqDB search
MRFSVLGSLCALVLLWAQPSCLGDEVTSSTGTVVNPCCYIPCQHRGICVRHGEEKYECDC
TRTGYYGENCTVPEFWTRVRHFLKPSPDVAHYILTHFHWLWDVINHTFLRDVLMRLVLTV
RSNLIPSPPTFNSKYNYLSWESYYNLSYYTRLLPPIPDDCPTPLGVRGKAGLPDPELLVE
KLLKRRTFRPDPQGTNLMFAFFAQHFTHQFFKTYNRMGLGFTKALAHGVDAGHVYGDNLE
RQLQLRLHKDGKLKYQVINGEVYPPTVLDTMVKMSYPPSVPPEHQIAIGQEVFGLLPGLG
MYATLWLREHNRVCDILKVEHPTWDDEQLFQTTRLIIIGETIKIVIEEYVQHLSGYMLQL
KFDPTLLFNTPFQYGNRIALEFSQLYHWHPLMPDSFLINGDEVTYTQFLFNTSVLTHYGV
DKLVDSFSRQVAGQIGGGHNINAIVTHVAVGAIKESRQLRLQPFNEYRKRFNLTPYASFQ
EFTDNEEIAGVLEELYGDIDTLEFYPGLMLEKTRPNAIFGESMVEMGAPFSLKGLLGNPI
CSPEYWKPSTFGGKVGFDIVNSATLKKLVCQNTRTCPYVAFHIPREEQSQSQGQKELNKD
GNDEL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgagattttctgtcctaggatcactctgcgctctcgtcttgctgtgggcgcagccgtca
tgcctgggggatgaggtgacctccagcacaggtactgtagtcaacccatgctgttacatt
ccctgtcagcacaggggcatttgtgtaagacatggagaggaaaagtatgagtgtgactgc
acgcgcaccggatactacggagaaaactgcaccgtcccggagttttggaccagagtgcgt
cacttcttaaagccaagcccagatgtggcacactacattctcacccatttccattggctg
tgggacgtcatcaatcacacgttcttacgtgatgttctcatgcggctggtgctcacagtt
aggtccaacctgatacccagccctccaacctttaactcaaagtacaactacctcagctgg
gaatcctactacaacttgagctactacacgcgcctactgcccccaataccagacgactgc
cccacacctttgggtgttagaggcaaggctgggctgcctgaccctgagctcctggttgaa
aagctgttgaagagaaggacttttagacccgatccccagggcaccaacctcatgtttgct
ttctttgcacagcatttcacccaccagttctttaagacctacaaccgcatgggtttaggt
tttactaaggctctagcacacggggtagacgcaggacacgtttatggagacaacttggaa
cgccagctccaacttaggcttcacaaagatggaaaactgaaatatcaggtcatcaatggc
gaagtgtaccctcccactgtactcgatacgatggtgaagatgagctaccccccaagtgtt
ccacctgagcatcagatcgctattggtcaggaagtgttcggacttctccctggtttggga
atgtacgccaccctgtggctgagggagcacaatcgagtctgtgacatcctgaaagtggag
catcccacgtgggacgatgagcagcttttccagaccacacgtttgatcatcatcggtgag
acgatcaaaatcgtgatcgaggagtatgtacagcacctcagtggctacatgctgcagctg
aagtttgatccaacgctgctgtttaacactcccttccaatatggaaaccgaatcgcactg
gagttcagccaactgtaccactggcatccgctgatgcctgacagcttcctcataaatgga
gatgaagtgacgtacacgcagtttctctttaacacgtccgtcctcacgcactacggcgtt
gacaagctggtggactctttctctcggcaagttgctgggcagatcggcgggggccataac
atcaatgcgattgtgactcacgtggctgtgggtgccataaaggaatctcgccagctccgg
ttgcagccgttcaatgagtacagaaaacgttttaacctgacgccctacgcatccttccag
gaattcactgataatgaagagatagccggcgtgttggaagaactctacggagacattgac
acactcgaattttatcccggtttaatgttggagaaaacaagacctaacgccatatttggg
gaaagcatggtggaaatgggagctcctttctcactcaaaggcctcctaggaaatcctata
tgttctccagaatattggaagcccagcacctttggaggcaaagtgggctttgacatagtg
aactctgccacgctaaagaagctggtttgtcaaaacaccaggacatgtccttatgtggca
tttcacatacctagagaggagcagtcccaatcccagggtcagaaagaattaaataaggac
ggaaacgacgagctatga

DBGET integrated database retrieval system