Cynoglossus semilaevis (tongue sole): 103396512 Help Entry 103396512         CDS       T04866                                  Symbol rheb Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism csem  Cynoglossus semilaevis (tongue sole) Pathway csem04140   Autophagy - animal csem04150   mTOR signaling pathway csem04218   Cellular senescence csem04910   Insulin signaling pathway csem05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:csem00001]  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     103396512 (rheb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103396512 (rheb)   09143 Cell growth and death    04218 Cellular senescence     103396512 (rheb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     103396512 (rheb)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     103396512 (rheb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:csem04031]     103396512 (rheb) GTP-binding proteins [BR:csem04031]  Small (monomeric) G-proteins   Ras Family    Rheb     103396512 (rheb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 SRPRB RsgA_GTPase AAA_14 RhoGAP_pG1_pG2 Reovirus_M2 ParE_toxin YebF Motif Other DBs NCBI-GeneID:  103396512 NCBI-ProteinID:  XP_008332853 UniProt:  A0A3P8WH08 LinkDB All DBs Position 20:10633251..10637757 Genome browser AA seq 184 aa AA seqDB search MPQPKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKMITINGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSNKSFEVVQVIHEKLLDMVGKVQVPIMLVGNK NDLHMERVISCEEGKALAESWNAAFMESSAKENQTAVEVFRRMILEAEKMDGGVQPGKPS CSMM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagcccaagtcacgaaaaatcgccatcctcgggtacagatccgtaggaaagtct tctctgacaattcagtttgtggaaggccagtttgttgactcctatgatcccacaatagaa aacacttttactaaaatgatcacaataaatggacaggagtaccatcttcagctggtagac acggcaggacaggatgagtactccatcttcccacagacatactccatagatatcaacggc tacattctggtctattcagttacatctaataaaagctttgaagttgtacaagtaatccac gaaaaactgttggacatggtggggaaagtacaagtaccgattatgctggtcgggaacaag aacgacctacacatggagcgagtaatcagttgtgaagagggaaaagcgttagctgaatcc tggaacgctgccttcatggagtcctcagctaaagagaaccagacggctgtggaagttttc cggaggatgatcctggaggcagagaagatggacggcggtgtgcagcctggaaagccatct tgctccatgatgtag

DBGET integrated database retrieval system