KEGG   Cynoglossus semilaevis (tongue sole): 103397316
Entry
103397316         CDS       T04866                                 

Gene name
trpv4
Definition
(RefSeq) LOW QUALITY PROTEIN: transient receptor potential cation channel subfamily V member 4
  KO
K04973  transient receptor potential cation channel subfamily V member 4
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:csem00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103397316 (trpv4)
Ion channels [BR:csem04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   103397316 (trpv4)
SSDB
Motif
Pfam: Ank_2 Ion_trans Ank_3 Ank Ank_5 Ank_4
Other DBs
NCBI-GeneID: 103397316
NCBI-ProteinID: XP_008333755
LinkDB
Position
Z
AA seq 867 aa
MNEGRSVLFRRGHLALSKADTLTSVSATSNVSEDAGDGVPTQMLDSDTVFPLSEFSHLFE
SEDATPSTQDTSQDSTIELVQPGQSTDGRQNLRMKFQGAFKKGISNPMDLLESTIYESNV
VQGPKKAPMDSLFDYGTYGHMSNQKRRRKKLPRGKTETSAEDDPSSDRPKVVKTFNRSLL
FDCVSRGDPGALEGLLEYLQTHGKRLTDEEFKEPSTGKTCLPKALMNLYGGQNETIPLLL
DIAEKTGNLREFINSPFRDVYYRGQTALHIAIERRCKQYVEVLVEKGADVHAQARGRFFQ
PRDEGGYFYFGELPLSLAACTNQPDIVHYLTENPHKKADLRRQDSRGNTVLHALVHIADN
TKDNTRFLTKMYDLLLIKSAKLYPECSLETVLNSDGMSPLMMAAKLGKIGIFQHIIRREI
KDEEVRHLSRKFKDWAYGPVYSSLYDLSFLDTCGEEPSVLEILVYNSRNENRHEMLAVEP
INELLRAKWQKFAAVTFYISVVSYLITMIIFTLVAYYHPTHGTPPYLYKSSSDYLRMAGE
IITLASGIFFFLTNIKDVFLKKCPGVRSLFIDGSFQLLYFIYSVLIVVTAALYLSGIKAY
VSVMVFALVLGWMNTLYFTRGLKLTGTYSIMIQKILFKDLFRFLLVYVLFMIGYASALVS
LLXPPGTDCDGGCPTYPDCRDPDTFSAFLLDLFKLTIGMGELDMIHSAQYPAVFLILLVT
YIILTFVLLLNMLIALMGETVGQVSKESKKIWKLQWAKTILDIERSFPVCLRKSFRAGEM
VTVGKNWDGTPDRRWCFRVDEVHWCHWNQNLAIINEDPGKSETSQTNALQQNRGLRRDRW
STVVPRVVELSKGREAVIEMEPLTRRR
NT seq 2604 nt   +upstreamnt  +downstreamnt
atgaatgagggtcgttctgttctcttcagaaggggccaccttgccttgtccaaggctgac
accttgacttctgtttcggccacgtctaatgtctcggaggacgcgggtgatggtgtgccc
actcagatgctggactctgataccgtgtttcccctgtcggagttttcacacttgtttgag
agtgaggatgccactccctcaacccaggacacaagtcaggattccaccatagagctggtt
cagccgggccaatcaacagacggtagacaaaacctacggatgaaattccagggtgctttt
aagaagggcatttccaatccaatggacctactggaatctacaatatatgagtccaatgtc
gtccaagggcccaaaaaagctcccatggactcactctttgactatggtacctatggacac
atgagcaaccagaagagacgcaggaagaagcttccaagaggaaaaactgagacgtctgca
gaagatgacccgagctcagaccgaccgaaggtggtaaaaacattcaaccgctcactgctc
tttgactgtgtgtcacgtggagaccccggagccctggaaggcctgctggagtaccttcaa
actcacggcaagagactaactgatgaagagttcaaagagccctctacaggtaagacatgt
ctgcctaaagccctgatgaacctttacggaggtcagaacgagaccatcccactgctgctg
gacatcgcagagaagactggaaacctcagagagttcatcaattcaccgttcagagatgtc
tactacagaggtcaaacagccctgcacattgctatagagcgtcgctgtaagcagtacgtg
gaggtactggtagagaagggagctgatgttcatgcccaggccagaggacggttcttccag
cctagggatgaggggggatacttttactttggtgagctgccgctctcattggctgcctgc
actaaccagcctgacattgtgcactacctgactgaaaacccacacaagaaggccgacctg
cgacgccaggattcacgtggaaacacagtactgcatgccctggttcacattgcagacaac
accaaggacaacacacgttttctcaccaagatgtacgatctgctgctcatcaaaagtgca
aagctctacccagaatgcagtctggagacagtgctcaacagcgatggcatgtctcctctc
atgatggctgccaaactaggaaaaatagggatttttcaacacattatcagacgggagatt
aaagatgaggaagttcgtcatctgtctcggaagtttaaggactgggcctacggtccggtc
tactcctctctttacgatctgtctttcctggacacgtgtggagaagaaccctccgtgctt
gaaattcttgtttacaacagtcgaaatgagaaccgtcatgagatgctggcagtggagccc
atcaatgagctgctgagagccaaatggcaaaagtttgctgcagtcaccttctacatcagc
gtggtttcgtacctcatcaccatgatcatcttcaccctggtggcttattaccaccccaca
catggaacacctccttacctgtacaaatcatcctctgactacctgcgcatggctggggag
atcatcaccttggcgtcaggaatcttctttttcctcaccaatatcaaagatgtcttcctg
aagaagtgtccgggtgtgaggtctttatttattgatggatcttttcagctgttgtatttc
atctactctgtactgattgtagtcacagctgctctctacctgtctggcattaaagcgtat
gtgtctgtgatggtgtttgcacttgtcctgggctggatgaacacactttacttcaccaga
ggcttgaagctcaccggcacatacagcatcatgatacagaagattctttttaaagatctt
ttcagatttctgctggtgtacgtactcttcatgattggatatgcttcagccctggtgtct
ctgctgnaaccacctggaactgattgtgatggaggttgtcccacctatcccgactgcagg
gacccagacactttcagtgccttcttgctagatcttttcaaactgaccatcggaatggga
gaactagacatgatccacagtgcacagtaccctgcagtcttcctcattctactggtgacc
tacatcatcctgacctttgtgctgctgctcaacatgttgatcgctttgatgggggagaca
gtaggacaagtgtctaaggaaagcaagaagatctggaagcttcagtgggcaaaaactatc
ttggacattgagcgatcatttccagtttgtctccgcaagtcattccgagctggtgagatg
gtgactgttgggaagaactgggatgggacacctgaccgtcgctggtgctttagagtggat
gaggttcactggtgtcactggaatcagaacctggctataatcaacgaggaccctggtaag
agtgagaccagccaaaccaatgcgctgcagcagaaccgtgggttaaggagagaccgttgg
tccacagtggtcccacgggtggtggagttaagtaaaggtcgtgaggcagtgatagagatg
gagcccctgacacgacgacgctga

DBGET integrated database retrieval system