Cynoglossus semilaevis (tongue sole): 107989622 Help Entry 107989622         CDS       T04866                                  Symbol apln Name (RefSeq) apelin   KO K05225   apelin Organism csem  Cynoglossus semilaevis (tongue sole) Pathway csem04080   Neuroactive ligand-receptor interaction csem04371   Apelin signaling pathway Brite KEGG Orthology (KO) [BR:csem00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     107989622 (apln)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     107989622 (apln)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csem04052]     107989622 (apln) Cytokines and neuropeptides [BR:csem04052]  Neuropeptides   Neuropeptides (GPCR binding)    107989622 (apln) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Apelin Motif Other DBs NCBI-GeneID:  107989622 NCBI-ProteinID:  XP_016894914 LinkDB All DBs Position 15:complement(1521560..1541973) Genome browser AA seq 77 aa AA seqDB search MNVKILTLVIVLLVSLLRSAGAGPMASVEHGREVEEAPTVRKMVQQSPARGGQPHRPAGW KRRRPRPRLSHKVPMPF NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgcgttcggct ggtgctggtcccatggcctccgtggagcatggcagagaagtagaagaagcccccacagtg agaaaaatggtccagcagagtcctgcaaggggaggtcaacctcacagaccggccggctgg aagaggagacgccctcggccccgtctgtctcacaaggtgcctatgccgttctag

DBGET integrated database retrieval system