KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c55060Help
Entry
Cspa_c55060       CDS       T02467                                 

Gene name
pfkA2
Definition
(GenBank) 6-phosphofructokinase PfkA
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
csr00010  Glycolysis / Gluconeogenesis
csr00030  Pentose phosphate pathway
csr00051  Fructose and mannose metabolism
csr00052  Galactose metabolism
csr00680  Methane metabolism
csr01100  Metabolic pathways
csr01110  Biosynthesis of secondary metabolites
csr01120  Microbial metabolism in diverse environments
csr01130  Biosynthesis of antibiotics
csr01200  Carbon metabolism
csr01230  Biosynthesis of amino acids
csr03018  RNA degradation
Module
csr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
csr_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:csr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cspa_c55060 (pfkA2)
   00030 Pentose phosphate pathway
    Cspa_c55060 (pfkA2)
   00051 Fructose and mannose metabolism
    Cspa_c55060 (pfkA2)
   00052 Galactose metabolism
    Cspa_c55060 (pfkA2)
  09102 Energy metabolism
   00680 Methane metabolism
    Cspa_c55060 (pfkA2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Cspa_c55060 (pfkA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:csr01009]
    Cspa_c55060 (pfkA2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:csr03019]
    Cspa_c55060 (pfkA2)
Enzymes [BR:csr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cspa_c55060 (pfkA2)
Protein phosphatases and associated proteins [BR:csr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cspa_c55060 (pfkA2)
Messenger RNA biogenesis [BR:csr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Cspa_c55060 (pfkA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AGF59251
UniProt: M1MXK2
LinkDB All DBs
Position
complement(6157247..6158203)
Genome map
AA seq 318 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAIRAVVRTALHNGIEVMGVQRGYSGLINGELFSMDRNSVSDI
IQRGGTVLRTARCPEFKNEEVRKKAAKILQAYGVEALVVIGGDGSFMGAKLLSKLGIKTI
GLPGTIDNDLAYTDFTLGFDTALNTVVDAINKIRDTSTSHERVSIVEVMGRDCGDLSLYA
GICGGAEAIIIPEIDFDKDALCRTILEGKNRGKMHNLVILAEGIGGAFELAKEVEEVTGI
ETRATILGHIQRGGSPTATDRVLASRMGARAIEVLLEGKTSRVIGIKDNKIIDQDIDEAL
DMESKFDKELYDIAQVLS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagctgtgttaacaagtggtggagatgcacctggtatgaatgctgcaatt
agagctgttgtaagaactgcccttcataacggtatagaagttatgggagttcaaagagga
tatagtggactaattaatggtgaattatttagtatggatagaaattctgtatctgatata
attcaaagaggtggaacagtactaagaactgcaagatgtccagaatttaaaaatgaagaa
gttagaaaaaaagctgctaaaatattgcaagcatatggtgttgaagcgttggtagttatc
ggcggagatggatcattcatgggtgcaaaattattatcaaagcttggaattaaaacaata
ggtttaccaggaacaatagataatgatttagcttacacagattttactttagggtttgat
acagctttaaatactgtagtagatgctataaataaaatcagagacacttcaacttctcat
gaaagagtttctattgtagaagttatggggagagactgtggcgatttatctttatatgca
ggtatttgtggtggtgcagaagcaatcataattcctgagatagattttgataaggatgca
ctttgcagaactatcttagaaggaaaaaatagaggaaaaatgcataatttagtaatcctt
gcagaaggaattggtggagcatttgaacttgcaaaagaagttgaagaagtaacaggaata
gaaacaagagcaacaatcttaggtcatattcaaagaggaggaagtcctactgctactgat
agagtcttagcttcaagaatgggagcaagagctatagaagtattattagaaggaaaaact
tcaagagtaattggaattaaagataataaaataatagaccaagatatagatgaagctcta
gatatggaaagtaaatttgataaagagctatatgatatagctcaagtattatcataa

DBGET integrated database retrieval system