KEGG   Candidatus Caldiarchaeum subterraneum: CSUB_C1706Help
Entry
CSUB_C1706        CDS       T02904                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
csu  Candidatus Caldiarchaeum subterraneum
Pathway
csu00620  Pyruvate metabolism
csu00680  Methane metabolism
csu00720  Carbon fixation pathways in prokaryotes
csu01100  Metabolic pathways
csu01120  Microbial metabolism in diverse environments
csu01200  Carbon metabolism
Module
csu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:csu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CSUB_C1706
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    CSUB_C1706
   00680 Methane metabolism
    CSUB_C1706
Enzymes [BR:csu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CSUB_C1706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 UPF0147 PEPcase
Motif
Other DBs
NCBI-ProteinID: BAJ51557
UniProt: E6N9G7
LinkDB All DBs
Position
complement(1630079..1631647)
Genome map
AA seq 522 aa AA seqDB search
MVNEERHIPRTMSSQHPDNVSSPPWLDTPLIEGDDEVEEVYQSWVTLGCEEAMWDAEGKD
VDLNVVRKLLTTHPEYFREKIIGRDHFLTYRIPNPSMEKSDRKVFFETLQSIPKHFDACE
AFYGRQVNPPVFEVILPFTTSVNQLIRVVNTYRKAVVQLEEIVIDYPNITLGDIIGKISP
EKIEVIPLFEDLDSMLNADTILGRFIELTSPRYVRAFIARSDPALNNGLVAATLMAKLAI
DKLQNLSTNTGIPVHTIIGVGTLPFRGGLSPTHLEKFYEEYGGVSTVTIQSAFRYDYPQN
IVKEAIKSINNTLPIEKRSTIIESVETVLKVIAKGSQAYRAFAEVAAPSIARVSALTPAR
RRRKLHVGAFAYSRVLGGVELPRAIPYACSFYTLGLPPEFIGLRFLYQLSEEEFDVLKEF
YNLAEDLRRVAPLVCFDNINTLLSEESKDKHELQPLREALPLYVEDLEAAQDLLNIKPGP
KTSSERKYSNILNNFLIAYMEENLEEARLELLRAAGIRRCLG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggttaacgaagagagacacattccgaggacgatgagttcgcagcatcccgacaacgtc
tccagcccgccgtggctagatacgccgctgatagagggtgatgacgaggttgaagaggtt
taccagagctgggtcacattgggatgcgaggaagcgatgtgggacgccgaagggaaagac
gtcgacctcaacgtcgtccgcaaactgctcacaacacatcccgaatatttccgcgaaaaa
ataatcgggagagaccatttcctcacataccgcatacccaacccatcgatggagaaaagc
gacaggaaagttttcttcgaaacactgcaaagcatacccaagcatttcgacgcatgcgag
gcattctacggccgccaggtgaacccgcccgtcttcgaagtcatcctccccttcaccaca
tcagtaaaccaactcatacgtgtggtcaacacctatagaaaagcggttgtccagctggag
gaaatagtcatcgactatccaaacatcacgctaggagacatcatcggaaaaatcagccca
gaaaaaatcgaggtcatcccacttttcgaagacctagactcgatgctcaacgccgacact
atactgggaaggttcatagagctgacctcgccgcgttatgtgcgagccttcatcgcccgc
tcagacccggcgctcaacaacggcctcgtcgcagccacgttgatggccaaactagccata
gacaagctgcaaaacctatccacaaacacaggcatacctgttcacacaatcataggcgtt
ggaacacttcctttcagaggcggactcagcccaacacatctagaaaaattctacgaagaa
tacggcggcgtatccacggtaaccatacagtccgccttccgctacgattatccacaaaac
attgtgaaggaagctataaagagcatcaacaatacattacccatcgaaaaacggtcaacg
ataattgagagtgttgaaacggttttaaaggttatcgccaaaggttcccaggcttatagg
gctttcgccgaggtggctgcaccatccatagcccgtgtctcggcgctgacgcctgcgagg
cggagacgcaagctacatgtcggtgctttcgcctactcgcgtgtgcttggaggggttgag
ctgccgagagccatcccatatgcatgctccttttacacactcggcctgcctcccgagttt
ataggcctccgcttcctctaccaactatctgaagaggaatttgatgtgttgaaggagttc
tacaatcttgccgaagatttgcgcagagtcgctccgctggtttgcttcgacaacatcaac
acgctgctgagcgaggaatccaaagataagcatgaactgcagccccttagagaagctttg
ccactctacgtcgaggacctcgaagccgcacaagatctcctaaacataaagccggggccc
aaaacatcttcggagagaaaatacagcaacatactcaacaatttcctcatagcatatatg
gaggaaaatttggaggaggcgcgtctggagctgcttagagcagccgggattagaagatgc
ctaggctaa

DBGET integrated database retrieval system