Chryseobacterium taihuense: NCTC12078_00282 Help Entry NCTC12078_00282   CDS       T07055                                  Symbol ssb_1 Name (GenBank) Helix-destabilizing protein   KO K03111   single-strand DNA-binding protein Organism ctai  Chryseobacterium taihuense Pathway ctai03030   DNA replication ctai03430   Mismatch repair ctai03440   Homologous recombination Brite KEGG Orthology (KO) [BR:ctai00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     NCTC12078_00282 (ssb_1)    03430 Mismatch repair     NCTC12078_00282 (ssb_1)    03440 Homologous recombination     NCTC12078_00282 (ssb_1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ctai03032]     NCTC12078_00282 (ssb_1)    03400 DNA repair and recombination proteins [BR:ctai03400]     NCTC12078_00282 (ssb_1)    03029 Mitochondrial biogenesis [BR:ctai03029]     NCTC12078_00282 (ssb_1) DNA replication proteins [BR:ctai03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     NCTC12078_00282 (ssb_1) DNA repair and recombination proteins [BR:ctai03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      NCTC12078_00282 (ssb_1)   TLS (translesion DNA synthesis) factors    Other SOS response factors     NCTC12078_00282 (ssb_1) Mitochondrial biogenesis [BR:ctai03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA replication factors    Other Mitochondrial DNA replication factors     NCTC12078_00282 (ssb_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB AgI_II_C2 DUF3217 tRNA_anti-codon Motif Other DBs NCBI-ProteinID:  VFB02307 UniProt:  A0A4U8W7U5 LinkDB All DBs Position 1:288187..288519 Genome browser AA seq 110 aa AA seqDB search MSLRNKVTLIGFTGKEVEKVNFENGGMKISVSLATNDHYTNAKGEKVEETQWHNLVAFGK TAEIFQKYVTKGKEIAIEGKLTYRSYEDKDGVKRFITEIRVDELLLLGSK NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgtcactaagaaacaaagtaaccttaatcgggttcacaggaaaagaagttgaaaaggta aacttcgaaaacgggggaatgaaaatttcagtttctctcgctacaaacgatcattacacc aacgctaaaggtgaaaaagtagaagaaacgcaatggcataatctggtggctttcggaaaa actgcggagatttttcagaaatatgtcaccaaaggaaaagaaatcgctattgaaggaaaa ttaacgtacagatcatacgaagataaagatggtgtgaaaagatttatcactgagataaga gtggatgaacttctgcttttaggcagtaaataa

DBGET integrated database retrieval system