KEGG   Chroococcidiopsis thermalis: Chro_0852Help
Entry
Chro_0852         CDS       T02360                                 

Definition
(GenBank) Glutathione S-transferase domain protein
Organism
cthe  Chroococcidiopsis thermalis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N DUF442 GST_N_2 GST_C_2 GST_C_3 Glutaredoxin GST_C GST_C_5 DSPc GST_N_4 Y_phosphatase3 Y_phosphatase
Motif
Other DBs
NCBI-ProteinID: AFY86393
UniProt: K9TVH7
LinkDB All DBs
Position
967985..969082
Genome map
AA seq 365 aa AA seqDB search
MAEITIYSATVCPYAHRSRLVLLEKGIDFELIEIDLQNKPAGFTEISPYGKVPVIKHGDV
RVWESAIINEYLDEVFPEPSLLPKEPVNRAQARIWIDFANTRFIWAYSNLLRSPDPQQQK
AAAQELYSQLEFIEKEGLEKLSGEGSYWFGNSISLVDLTFYPWFERWSALEHYRGFGLPP
EFTRLQQWRKAVSQRESVKAIANPTEYYIQRYARFAAPIAKKVSDELSVAGKLTLEQLQQ
AAQQGFKSVLNLRSPDEPGFLSDEQQQAQAAGLDYANIPLQSSEPDLISTKEAIRATENL
PKPILIHCAAGARAGGIALIATAIQQGLTYEQIQEKAQQVDLDLNQPHLQQFLLENYTAK
QETES
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaatcacaatttacagtgccacagtttgtccttacgctcatcgctcgcgccta
gttttactagagaaaggaattgacttcgagctgattgaaatcgatctacaaaataagcca
gcgggatttacagagatctcaccctacggcaaagttccggtaatcaagcatggggatgtg
cgggtttgggaatcggcaattattaatgaatatctcgatgaagtatttccagaaccgtca
ctgttgccaaaagagcctgtaaatagagcgcaagccagaatttggattgattttgctaat
actcggtttatctgggcttattccaatcttctacgttctccagatccgcaacaacaaaag
gcagcggcacaggagttatacagtcagctagaatttattgaaaaagagggtttagaaaaa
ctatctggagaaggatcgtattggtttggtaattctattagtttagtcgatctcaccttc
tatccttggtttgaaagatggtcggcgctcgaacattatcgcggttttgggctaccacct
gaattcacgcggttgcagcaatggcggaaagcagtaagtcaacgcgaatctgtgaaggcg
atcgccaatccaacagaatactatattcagcgatatgctagatttgccgcacccatagct
aaaaaagtgagcgacgagctgagcgtagctggaaaactcactctagagcagttgcaacaa
gcagcgcaacaaggttttaagtcggtgttgaatttacgctctcctgatgaaccaggtttc
ctcagcgacgaacaacagcaagcacaagcagcaggattagattacgctaacattccccta
caatcttcagaaccggatctaatatcaacaaaagaagcaattcgagccactgaaaattta
ccaaagccaattttaatccactgcgctgctggggcaagggcaggtggaatcgctttaatt
gccactgcgattcaacaaggcttaacttacgagcaaattcaggaaaaagctcaacaagtc
gatctcgatttaaatcaaccccacttgcagcaatttctgctggaaaactacactgccaag
caggaaacagaaagttag

DBGET integrated database retrieval system