KEGG   Chroococcidiopsis thermalis: Chro_0852
Entry
Chro_0852         CDS       T02360                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
cthe00480  Glutathione metabolism
cthe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cthe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Chro_0852
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cthe02000]
    Chro_0852
Enzymes [BR:cthe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Chro_0852
Transporters [BR:cthe02000]
 Other transporters
  Pores ion channels [TC:1]
   Chro_0852
SSDB
Motif
Pfam: GST_N_3 GST_N GST_N_2 DUF442 GST_C_2 GST_C_3 Glutaredoxin GST_C GST_C_5 DSPc GST_N_4 Y_phosphatase3 Y_phosphatase
Other DBs
NCBI-ProteinID: AFY86393
UniProt: K9TVH7
LinkDB
Position
967985..969082
AA seq 365 aa
MAEITIYSATVCPYAHRSRLVLLEKGIDFELIEIDLQNKPAGFTEISPYGKVPVIKHGDV
RVWESAIINEYLDEVFPEPSLLPKEPVNRAQARIWIDFANTRFIWAYSNLLRSPDPQQQK
AAAQELYSQLEFIEKEGLEKLSGEGSYWFGNSISLVDLTFYPWFERWSALEHYRGFGLPP
EFTRLQQWRKAVSQRESVKAIANPTEYYIQRYARFAAPIAKKVSDELSVAGKLTLEQLQQ
AAQQGFKSVLNLRSPDEPGFLSDEQQQAQAAGLDYANIPLQSSEPDLISTKEAIRATENL
PKPILIHCAAGARAGGIALIATAIQQGLTYEQIQEKAQQVDLDLNQPHLQQFLLENYTAK
QETES
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggcggaaatcacaatttacagtgccacagtttgtccttacgctcatcgctcgcgccta
gttttactagagaaaggaattgacttcgagctgattgaaatcgatctacaaaataagcca
gcgggatttacagagatctcaccctacggcaaagttccggtaatcaagcatggggatgtg
cgggtttgggaatcggcaattattaatgaatatctcgatgaagtatttccagaaccgtca
ctgttgccaaaagagcctgtaaatagagcgcaagccagaatttggattgattttgctaat
actcggtttatctgggcttattccaatcttctacgttctccagatccgcaacaacaaaag
gcagcggcacaggagttatacagtcagctagaatttattgaaaaagagggtttagaaaaa
ctatctggagaaggatcgtattggtttggtaattctattagtttagtcgatctcaccttc
tatccttggtttgaaagatggtcggcgctcgaacattatcgcggttttgggctaccacct
gaattcacgcggttgcagcaatggcggaaagcagtaagtcaacgcgaatctgtgaaggcg
atcgccaatccaacagaatactatattcagcgatatgctagatttgccgcacccatagct
aaaaaagtgagcgacgagctgagcgtagctggaaaactcactctagagcagttgcaacaa
gcagcgcaacaaggttttaagtcggtgttgaatttacgctctcctgatgaaccaggtttc
ctcagcgacgaacaacagcaagcacaagcagcaggattagattacgctaacattccccta
caatcttcagaaccggatctaatatcaacaaaagaagcaattcgagccactgaaaattta
ccaaagccaattttaatccactgcgctgctggggcaagggcaggtggaatcgctttaatt
gccactgcgattcaacaaggcttaacttacgagcaaattcaggaaaaagctcaacaagtc
gatctcgatttaaatcaaccccacttgcagcaatttctgctggaaaactacactgccaag
caggaaacagaaagttag

DBGET integrated database retrieval system