KEGG   Chaetomium thermophilum: CTHT_0017170Help
Entry
CTHT_0017170      CDS       T03100                                 

Definition
(RefSeq) glutamate decarboxylase-like protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cthr  Chaetomium thermophilum
Pathway
cthr00250  Alanine, aspartate and glutamate metabolism
cthr00410  beta-Alanine metabolism
cthr00430  Taurine and hypotaurine metabolism
cthr00650  Butanoate metabolism
cthr01100  Metabolic pathways
cthr01110  Biosynthesis of secondary metabolites
Module
cthr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CTHT_0017170
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CTHT_0017170
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CTHT_0017170
   00430 Taurine and hypotaurine metabolism
    CTHT_0017170
Enzymes [BR:cthr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CTHT_0017170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 18255755
NCBI-ProteinID: XP_006692219
UniProt: G0S2G7
LinkDB All DBs
Position
Unknown
AA seq 514 aa AA seqDB search
MTITNGTKALNRADEVDRLLDAVKALIIPFIRAADEAVPSRAVGELLPNANGVVENTLVD
YRKPEDLAQEMALSLPAGEGRGAGGLLDAIQQVLKYSVNTWDQGFMDKLYASTNPVGVVS
ELLLVSPALTVIEKHTAKTLAGLFGFTGPRAGGVTCQGGSSSNLTSLVIARNTLYPECKI
NGNAGASSRFVLFTSQHGHYSVEKAAIICGMGSAAVWTVPVDKTGRMNPVALRELVVRAR
EEGKTPLYVNATAGTTVLGSYDPFEEIAAVCREFGLWLHIDASWGGPAIFSKKHRWKMAG
SHLANSLTVNPHKMLNVPVTCSFLLGPDMAIFHKANTLPAGYLFHGPDAQAQANGTSSPA
AAVFSDPEPPEVWDLADLTLQCGRRADSLKLYLSWVYHGASGFATQIDHAFDVAAHLADL
IDKHPDFVLVSTNPPPCLQVCFYHAPGGSLSEDKEANTQRTRKMVEGLVKRGYMVDYAPG
EKGSFFRVVVNAQTRRGTVEGLVRALEAVGKEVE
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgactatcaccaacgggacgaaggctctgaatagggccgatgaggttgaccggctcctc
gatgccgtcaaagccctgatcatccccttcatccgggcggccgatgaggctgtgccatcc
cgggctgtcggtgagctgcttcctaacgccaatggcgttgtcgagaataccctcgtcgac
taccggaagcccgaggaccttgcccaggagatggccctctctttgcctgcgggagagggc
cgtggcgctgggggtctgctggatgccatccaacaggtactcaagtatagtgtgaacacc
tgggatcagggcttcatggataagctctatgccagcaccaatcctgtcggtgtggtctcc
gagcttctcctggtctctcccgccctcaccgtcatcgagaagcacacggccaagaccctg
gccggcctatttggcttcacgggtccccgtgctggcggtgtcacgtgccaaggaggtagc
tcgtcgaatctcacctcactggtcattgcacgcaacacgctgtacccagaatgcaagatc
aacggcaatgccggtgcttccagccgcttcgtgctcttcactagccagcacggccactac
tcggttgagaaagcggctatcatctgcggaatgggctctgctgccgtttggactgtcccc
gttgacaaaactggtcgcatgaacccggtagccctgcgcgaactggttgtgcgtgctcgg
gaggagggcaagaccccgctgtacgtcaatgccacagccggcaccacggttctggggtcg
tacgatcccttcgaggagattgcggctgtgtgccgtgagtttggtctgtggttgcacatc
gatgccagctggggcggcccagccatcttctcgaaaaaacatcgttggaagatggccggc
tcgcatctggcgaattcactgacggtgaacccgcataaaatgctcaacgtcccggtcaca
tgctcgttcctgctcggtccggacatggccatcttccacaaggcgaataccctgccagca
ggctacctcttccacggccccgatgctcaggcacaggcaaatggcacctcatcaccagcg
gctgccgtcttttccgaccctgagcccccggaggtctgggacctggccgacctgaccctg
cagtgtggtcgtcgcgccgactcgctcaagctctacctcagctgggtctaccacggtgcc
tctggcttcgcgacgcagatcgatcatgccttcgacgtggccgctcacctggccgacctg
atcgacaagcatccggactttgtcctcgtctcgacgaaccctcccccgtgtcttcaggtg
tgcttctaccatgcccctggtggctcgctgagcgaggataaagaggcaaatacccagcgc
acgcggaagatggtcgaggggctagtgaagagggggtacatggttgattatgcgccgggg
gagaagggaagcttctttagggttgtggtgaatgcacagacgaggagggggactgttgag
gggttggttagggcgttggaagcagttgggaaggaggttgagtag

DBGET integrated database retrieval system