KEGG   Chaetomium thermophilum: CTHT_0027060Help
Entry
CTHT_0027060      CDS       T03100                                 

Definition
(RefSeq) alkaline phosphatase-like protein
Organism
cthr  Chaetomium thermophilum
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Abhydrolase_6 Hydrolase_4 Abhydrolase_1 DSPc Metalloenzyme Thioesterase LIDHydrolase PTPlike_phytase PGAP1 Y_phosphatase Lipase_3
Motif
Other DBs
NCBI-GeneID: 18256744
NCBI-ProteinID: XP_006693164
UniProt: G0S6W0
LinkDB All DBs
Position
Unknown
AA seq 1143 aa AA seqDB search
MSSPDEYDAKANDPPLIERFSTIKSYTTTQATYPKLRVFYRRHQQANCLPTSPAPIPLLV
FIHGLGGSVAQFHALLTSLTPIASCLAVDLPGCGLSDFEPKDWESYSTDALIELLETVIE
DHREVAAGQGVILIGHSMGASLAALLANPRKPVTELHKHVLGLVGICPSAMQLTPIQLAV
LRALLWIPGFIFDLWRAWDRRGGLESPSVHRFVGANADAESKRLQCMYNHQSKTAVWRRM
AWGALPKSVRAGATPSGMPSLDVWAGLDMPVFLVGGEDDVVTPVTEIDKIASRLQSTTSA
EGDESTSEFVGQSEEQPQEQAQAKTQDTGLANGIPPLPSHPKKVVVTTKLPKPAGHGLLY
SPATAPILSGLISDFLSAHVTGRLSLGWQLQYLCKDGKWDVKNLEKWRNVAPVSAPIGGV
FRAIKTLREVDDEHCPRVFVQRWGNVIKDIVDISHDNPVYDPSGLEAGGIHYHKYPTVSK
VPPSESEIRGFVDVVDKIRAEQKVRAKIEGWKDGYAVGVHCHYGFNRTGFLIACYLVERC
GFTAKEAIEAFAKARPNGIRHEHFKDRLPTELAKSKSSAAMSPSSERTPLLADAQPRTSE
DSTRRAEEEDAALHGQTLPPAPRSRGLVMRELILFIWALAATAGAIILAVIVQHRDSTTP
SAPLAPGSPSAGEPYKKNGSKSQKRNLIFMVSDGMGPASLSLTRSFRQYTSSLPYDDTLT
LDKHFWGTSRTRSTNSWVTDSAAGATAFSCGRKSYNGAIAMLPGHKPCGTQDEIALHEIG
EGVLGRVVDVILGGGRCHFLSNQTQGSCRQDSIDVISIGQKRHGWTYAGDRAAFDQLAQG
KNATLPLIGLFAQTDVPFEIDRRHMTDIYPSLSEMAATALTALEEATKDSDKGFFLMIEG
SRIDHAGHINDPAAQVREVLEYDKTFKLVLDFLEKSDTEGILVATSDHETGGLATAWQAP
DELPVYNWHPSVLARANASAEYLSFLLRDHILASPSDQESLMSWINTHLVTKYLGITDAL
ETELSALASNPLAAPSIFARMVSTRARVGWSTHGHSAVDVNIYSSGGPAVEKLRGNVENT
DIGQFLIDYLGVDVDQITKELREKMGIEEKEEEVTVMDKEWEKEDKQVTGGHPVEWLKNV
IDL
NT seq 3432 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcccccgacgagtatgatgccaaagccaacgacccaccgctcattgagcggttt
tcgacgataaagtcgtacaccacgacgcaggctacctaccccaaactccgtgttttctac
cggcgacatcagcaggcaaattgcctacctacctcgccagcgcctatccctctcctggtc
ttcattcatggccttggaggatctgtcgcccagtttcatgctctgctcaccagcctcact
ccgatagcctcgtgtctcgccgtggacctcccgggctgtggtctctccgattttgagccc
aaggactgggagtcctattcgaccgatgcactgatcgagcttctcgaaacagtcatcgaa
gaccaccgagaggtggcagcaggccaaggggtgatcctgatcggccatagtatgggcgcc
tctcttgctgccttgctagccaatccaagaaaacctgtgaccgagttacacaaacacgtc
ctcggccttgtgggcatctgcccaagcgccatgcagctgacccccattcagttggccgtc
ttgcgcgcactgctctggattcctggcttcattttcgacctgtggcgagcatgggacaga
cgcggcgggctcgaaagccccagcgtgcatcgtttcgttggggccaatgccgacgccgag
tcgaagcgcctccaatgcatgtacaatcaccagagcaagaccgctgtctggcggcgcatg
gcctggggcgcgctgcccaagtccgtaagagctggagcgactccgagcggtatgccctcg
ctggatgtatgggcaggcctcgacatgcctgtgttcttggtagggggcgaggacgatgtg
gttacccctgtgaccgagatcgataaaatcgccagccgtttgcagtcgaccacctctgca
gagggcgatgagtcgaccagcgaatttgtcggacagagcgaagagcaaccacaagaacag
gcgcaagcaaagacacaggataccgggctggcgaacggtatccctccattgccgtctcac
ccaaaaaaggttgtggttaccacgaagctgcccaagccagccggccacggcttgctgtac
agtccagccacagcacctatcctctctggtcttatctccgactttctgtccgcccatgtc
actggcaggctctccctaggctggcagctgcagtacctatgcaaggacggcaagtgggac
gtgaagaatctggagaagtggcgcaacgttgcccccgtctctgcacccatcggcggcgtg
ttccgggcgataaagacgctccgtgaggtcgacgatgagcactgcccgcgtgtctttgtg
cagcgctggggaaatgtgatcaaggacatcgtcgacatctcacacgacaacccggtctat
gatccgagcggcctcgaggccggcggcattcattaccacaagtacccgaccgtgtccaaa
gtgccgcctagcgagtctgagatccgtggcttcgtcgatgttgttgataagatccgcgcc
gagcagaaggtgcgcgctaagatagagggctggaaggacgggtacgcggtcggcgtgcac
tgccattatggtttcaaccgcaccggcttcctgattgcctgctacctcgtcgagcggtgc
gggttcaccgctaaggaggccattgaagcatttgctaaggccaggcccaacgggatcagg
cacgagcatttcaaggatcgcctacctactgagctagcaaagtcaaagtcatcggctgcg
atgtccccgagctcggagcgtacgccgctcctggcggacgcccagccgcgcacgtccgaa
gactcgacccgccgtgcggaagaagaagatgccgcccttcacggccagacactccctcct
gcccctcgatcgcgcggtctggtcatgcgcgaactgatcctcttcatctgggcgctggct
gcaactgccggtgccatcatcctcgccgtgattgtccagcatcgggactcgacgacacct
tcagctcccctcgcacccggctctccctcggccggcgagccctacaagaagaatggttcc
aagagccaaaaacgcaatcttattttcatggtctcggacggaatgggtcctgcgtcgctc
tcgctgactcgatccttccggcaatacacttcctcactgccctacgacgacacgctgaca
cttgacaagcacttctggggcacttcgcgcacgcgctcgaccaatagctgggtaactgac
tcggccgccggcgccacagccttctcctgtggccgcaagagctacaacggtgccatcgcg
atgctgcctggccacaagccttgtggaacccaggacgagattgctctgcacgaaatcggc
gagggtgtgctgggtcgtgtagtcgacgtgatcctgggcggcggacgttgccatttcctc
agcaaccagacacagggcagctgcaggcaggatagtattgatgtcatttcaatcggccag
aaaaggcatgggtggacatacgccggcgaccgggccgcgttcgaccagctcgcgcagggc
aagaacgcgactcttccgctgatcggcctgttcgctcagaccgacgttcccttcgagatt
gaccgtcgtcacatgaccgatatctatcccagcctgagtgagatggcggccacggcactg
acagcgcttgaggaggctactaaggacagtgataagggcttcttcctcatgattgagggc
agtaggatcgatcatgcgggccatatcaatgaccctgccgctcaggtcagggaggtcttg
gagtacgataaaacattcaaacttgtgctggacttccttgagaagtccgacacagagggc
attctggttgccacgagcgaccacgagactggaggcctggctactgcgtggcaggccccc
gacgaactccccgtctacaactggcatccctcagtcctggcccgtgccaacgcctccgca
gagtacctctccttcctcctgcgcgaccacatcctagcctctccctctgaccaagaatct
cttatgtcgtggatcaacacccaccttgtcaccaagtaccttggcatcaccgacgccctg
gaaactgagctcagcgctcttgcttcgaaccccctcgctgccccatccatcttcgctcgc
atggtcagcacccgcgcccgtgtcgggtggagtacccacggccatagcgccgtggatgta
aacatctactcgtctggtggccccgcggttgagaagctcaggggaaatgtggaaaacacg
gatatcggccagttcttgattgattacctaggtgtggatgtggatcagattacgaaggag
ttaagggagaagatgggaattgaagagaaggaagaagaggttaccgtaatggacaaagag
tgggagaaggaggataaacaggtgacgggtgggcatcctgtcgagtggcttaagaatgtt
attgacttgtga

DBGET integrated database retrieval system