KEGG   Chaetomium thermophilum: CTHT_0042870
Entry
CTHT_0042870      CDS       T03100                                 

Definition
(RefSeq) hypothetical protein
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
cthr  Chaetomium thermophilum
Pathway
cthr00270  Cysteine and methionine metabolism
cthr00280  Valine, leucine and isoleucine degradation
cthr00290  Valine, leucine and isoleucine biosynthesis
cthr00770  Pantothenate and CoA biosynthesis
cthr01100  Metabolic pathways
cthr01110  Biosynthesis of secondary metabolites
cthr01210  2-Oxocarboxylic acid metabolism
cthr01230  Biosynthesis of amino acids
Module
cthr_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
cthr_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CTHT_0042870
   00280 Valine, leucine and isoleucine degradation
    CTHT_0042870
   00290 Valine, leucine and isoleucine biosynthesis
    CTHT_0042870
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CTHT_0042870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cthr01007]
    CTHT_0042870
Enzymes [BR:cthr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     CTHT_0042870
Amino acid related enzymes [BR:cthr01007]
 Aminotransferase (transaminase)
  Class IV
   CTHT_0042870
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 18258325
NCBI-ProteinID: XP_006694688
UniProt: G0SAN1
LinkDB
Position
Unknown
AA seq 414 aa
MMRHQLFRSAAHASALSAGRTGLAAPAWQQAVRQYSIAPAASETKLADIDPSQLVIERTT
NPKPLKAAKDLIFGRNFTDHMLMIEWQNTTGWQAPRIVPYQNLSLDPATCVFHYAFECFE
GMKAYKDKAGNIRLFRPDKNMERFNKSAARIALPNFNGSALIELIAKFTKLESRFIPEER
GYSLYLRPTLIGTQKTLGVGPPGSALLFVIASPVGPYYPTGFKAVSLEATDYAVRAWPGG
VGDKKLGANYAPCVVPQREAMGRGFQQNLWLFGEQEYVTEVGTMNFFVALRNKETGQKEL
ITAPLDGTILEGVTRDSVLSLARERLVPQGWNVVERKYTMKELDEAANEGRLIEAFGSGT
AAIVSPVRHISWKGKLINCGLKDHEESGEIAAKMKEWIEARQYGDDEHEWSYIC
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgatgcggcatcaactattcaggagcgctgcccacgcttcggctctctccgcggggcga
actggccttgctgctcctgcgtggcagcaggctgtgcgccagtacagcattgctccggct
gcttcagagacgaaactggccgatattgacccgtcccagctcgtcatcgagcggacaact
aaccccaagccgctcaaagctgccaaggacctcatctttggccgcaacttcaccgaccat
atgctcatgatcgagtggcagaacaccacgggctggcaagcgccgcgcatcgtgccttac
cagaacctgtccctcgacccggccacctgcgttttccactacgccttcgagtgcttcgag
ggcatgaaggcctacaaggacaaggccggcaacatccggttgtttcgcccagacaagaac
atggagcgcttcaacaagtccgccgcgcgcatagccctgcccaacttcaacggcagcgcc
ctgatcgagctgatagccaagttcaccaagctggagagccgcttcattcccgaagagcgc
ggctactctctgtacctgcgtccgacgctgatcggcacgcagaagacactgggcgtcggc
ccgccgggctcggccctcctcttcgtcatcgcctcgcccgtcggcccgtactacccgacg
ggtttcaaggctgtctcgctcgaggcgaccgactacgccgtgcgcgcctggcccggcggc
gtcggcgataagaagctgggcgccaactacgcgccgtgcgtggtgccgcagcgcgaggcc
atgggccgcggcttccagcagaacttgtggttgttcggcgagcaggagtatgtgacggag
gtgggcactatgaacttctttgtggcgctgcgcaacaaggagacgggccagaaggagctc
atcacggcgccgctggacggcaccatcctggagggcgtcacccgcgactcggtcttgtcg
ctggcccgcgagcgtcttgttcctcagggctggaacgtcgtggagcgcaagtacaccatg
aaggaactcgacgaggctgccaacgagggtcgtctcattgaggccttcggctcgggcacg
gctgccattgtcagccctgtccgccacatcagctggaagggcaagctgatcaactgcggt
ttgaaggaccatgaggagtcgggcgagatcgctgccaagatgaaggagtggatcgaggcc
cggcagtatggtgatgatgagcacgagtggagctacatttgctag

KEGG   Chaetomium thermophilum: CTHT_0055720
Entry
CTHT_0055720      CDS       T03100                                 

Definition
(RefSeq) hypothetical protein
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
cthr  Chaetomium thermophilum
Pathway
cthr00270  Cysteine and methionine metabolism
cthr00280  Valine, leucine and isoleucine degradation
cthr00290  Valine, leucine and isoleucine biosynthesis
cthr00770  Pantothenate and CoA biosynthesis
cthr01100  Metabolic pathways
cthr01110  Biosynthesis of secondary metabolites
cthr01210  2-Oxocarboxylic acid metabolism
cthr01230  Biosynthesis of amino acids
Module
cthr_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
cthr_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CTHT_0055720
   00280 Valine, leucine and isoleucine degradation
    CTHT_0055720
   00290 Valine, leucine and isoleucine biosynthesis
    CTHT_0055720
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CTHT_0055720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cthr01007]
    CTHT_0055720
Enzymes [BR:cthr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     CTHT_0055720
Amino acid related enzymes [BR:cthr01007]
 Aminotransferase (transaminase)
  Class IV
   CTHT_0055720
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 18259610
NCBI-ProteinID: XP_006695902
UniProt: G0SC31
LinkDB
Position
Unknown
AA seq 384 aa
MAPFPPPPVNTIDWSNVGFKVREVNGHIESHYSVKTGKWSPLKFVADPYIRIHGMAPALN
YGQQAYEGLKAFRLPNDSGIAIFRPDRNAERMQRSAEFVSIPPVPTDLFLDAVKAAVALN
AEYVPPHETGAAMYIRPQIYGSSAQLGLSPPEEYTFCVFVIPTGVYHGTHPVKCLILDEF
DRAAPNGTGSAKVGGNYAPVLRWSEKAHKEGFGITLHLDSKKHEEVDEFSTSGFIGVIVD
GEDVTMVVPDSKAVIDSVTSDSIQQIGRSFGWKVEKRAIKYSELPNFTEVMAAGTAAALV
PIRSITRRIAPTLPQDHPRVSVKEGEETITYIPDNIEEPGPLCTKLLAQLKGIQLGKLED
SFGWRFEVTEEDGKRVLNNGNISA
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggcgcctttccctccaccccccgtcaataccattgactggtcaaacgttggcttcaag
gttcgcgaagtcaatggccacatcgagtcgcactactctgtcaagacgggcaaatggtca
ccgctcaagttcgttgctgacccttacatccgtatccatggcatggctccggccctcaac
tacggccaacaagcctacgaaggcctgaaggctttccgcctgcccaatgattcgggaatt
gccatcttccgcccggatcgtaacgccgagcggatgcagcgcagcgccgaatttgttagc
atcccacccgtgcccactgacctcttcctcgatgccgttaaggcggctgttgccctcaat
gccgagtatgtgccaccgcatgagaccggcgcggccatgtacatccggccacagatctat
ggttcatcggcccagctgggtctcagcccacccgaagagtacaccttctgcgtgttcgtc
atcccgaccggcgtgtaccacggcacgcatcccgtcaagtgcttgatcctggacgagttt
gaccgcgcggcgcccaacggcactggcagcgccaaggttggcggtaactatgcacctgtg
ctgcggtggagcgagaaagcccacaaggaaggctttggcatcaccctgcacctggatagc
aagaagcacgaggaggtcgatgagttcagcacaagtggttttataggcgttattgtcgat
ggcgaggatgtgacgatggtcgtgccggatagcaaggctgttatcgacagcgtgacgagc
gatagcatccagcagattgggcgtagctttgggtggaaggtcgagaagcgggcaattaag
tactccgagcttcctaacttcactgaagtcatggccgcggggacggctgcagcgcttgtg
cccatccgctccatcactcgacgcattgcccccactcttcctcaggaccacccacgtgta
tcggttaaggagggcgaggagaccatcacctacattcccgataatattgaggagcctggc
ccgctgtgcacgaagctacttgcccagctcaaaggcatccaactcggcaagctggaggat
tcctttggctggcgttttgaggtcaccgaggaggatggcaagcgcgtcctcaacaacggg
aacatctctgcatag

KEGG   Chaetomium thermophilum: CTHT_0062930
Entry
CTHT_0062930      CDS       T03100                                 

Definition
(RefSeq) hypothetical protein
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
cthr  Chaetomium thermophilum
Pathway
cthr00270  Cysteine and methionine metabolism
cthr00280  Valine, leucine and isoleucine degradation
cthr00290  Valine, leucine and isoleucine biosynthesis
cthr00770  Pantothenate and CoA biosynthesis
cthr01100  Metabolic pathways
cthr01110  Biosynthesis of secondary metabolites
cthr01210  2-Oxocarboxylic acid metabolism
cthr01230  Biosynthesis of amino acids
Module
cthr_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
cthr_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CTHT_0062930
   00280 Valine, leucine and isoleucine degradation
    CTHT_0062930
   00290 Valine, leucine and isoleucine biosynthesis
    CTHT_0062930
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CTHT_0062930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cthr01007]
    CTHT_0062930
Enzymes [BR:cthr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     CTHT_0062930
Amino acid related enzymes [BR:cthr01007]
 Aminotransferase (transaminase)
  Class IV
   CTHT_0062930
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 18260331
NCBI-ProteinID: XP_006696601
UniProt: G0SE93
LinkDB
Position
Unknown
AA seq 415 aa
MIPQKRPAEDLAATALEHKIAEQPALSNGSANGTGNGSSLAPLDASKLIITRADPAARPV
PDEATACSGNETVCTDHMITVSWNSSTGWSAPELKPYGPLTLMPTASVLHYATECFEGLK
AFRGFDGKLRLFRPDLNCKRMLMSTLRISLPGFDPAELEKLIIMLMSIDGPKWLPASRPG
SFLYLRPAIIGTQPQLGVQTPKEALLFITASFMPRMDSPKGGMKLHTNPEDMVRAWVGGF
GYAKVGANYGPSLLATNEAKERGFTQILWLYGKEGYCTEAGASNFFLVWKTPEGKTQLIT
APLDDKLILDGVTRRSVVQLAKERLADELEVVERKYTIDEVIQAHKEGRIVEAFAAGTAF
FICPVSQIRHRDVDVHIPMAQGDVGEYTAKIKQWMANIMYGKEQHPWGVVVEEQQ
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgatcccccagaagcgccccgccgaggacctcgccgcgactgctcttgagcacaagatc
gccgagcagcccgctctctccaacggcagcgccaatggcaccggcaacggcagctccctg
gctcccctggacgcatccaaattgatcattacccgcgctgaccctgccgctcgccccgtc
ccggacgaagccactgcgtgctccggcaacgagaccgtctgcactgaccacatgatcacc
gtctcctggaattcctcgaccggctggtccgcgcctgagctgaagccgtacggacccctg
accctgatgcccacggcctcggtgctgcactacgcgactgagtgcttcgagggtctcaag
gccttccgcggcttcgacggcaagctgcggctgttccggccggatctgaactgcaagcgc
atgctcatgtcgacgctgcgcatctccctgcccggcttcgatcctgccgagctggagaag
ctcatcatcatgctcatgtccattgacggaccaaagtggctgcccgcttcccgcccaggc
tcgttcttgtacttgcgcccagccatcatcggcactcagccgcagctcggtgtgcagacg
cccaaggaggcgctgctctttatcacagcctccttcatgccgcgcatggatagccctaag
ggcggcatgaagctgcacaccaatccggaagacatggttcgtgcgtgggtgggcggcttc
ggctacgccaaggtcggcgccaactacggcccaagcctgctggcgacgaacgaggcgaag
gagcgtggcttcacccagattttatggctgtacggtaaggagggctactgcactgaggcc
ggtgctagcaacttcttcctggtgtggaagactcccgagggcaagactcagttaattacc
gcgccgctcgatgataagctcattttggacggtgtcactcggagaagcgtggttcagctg
gccaaggagaggcttgcggatgaactggaggttgttgagcgcaaatataccatcgatgag
gtcattcaggctcacaaggagggccgtattgtcgaggctttcgctgctggcactgccttc
ttcatctgccccgtttcccagatccgccaccgcgatgtcgatgttcacatcccaatggct
cagggagatgtcggcgagtacacggccaagatcaagcagtggatggccaatatcatgtac
ggcaaggagcagcacccgtggggtgttgttgttgaggaacagcagtag

DBGET integrated database retrieval system