KEGG   Chaetomium thermophilum: CTHT_0054960Help
Entry
CTHT_0054960      CDS       T03100                                 

Definition
(RefSeq) alpha-glucosidase-like protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cthr  Chaetomium thermophilum
Pathway
cthr00052  Galactose metabolism
cthr00500  Starch and sucrose metabolism
cthr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CTHT_0054960
   00500 Starch and sucrose metabolism
    CTHT_0054960
Enzymes [BR:cthr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CTHT_0054960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 18259534
NCBI-ProteinID: XP_006695829
UniProt: G0SBV8
LinkDB All DBs
Position
Unknown
AA seq 1063 aa AA seqDB search
MRVLTPSLSAVGTEPAGNILNSSVLKPVGRSLSHTILQSYADRVSSSSSFSRLPCSLVTT
KAIRLMKPLIVLIIGIRVVFAEAAREASIEAEVKPTIWANIHKSNPVSSVKEKFLSGWRR
KIFQLDDIESLNSLAFEVDTGQNVLPNIKDPEAINPQAICPGYKAADVRYTQDGSFTASL
HLAGKPCNLYGNDIEHLILEVEFQASDRLHIEIKPRYIGQENETWFLLPDVLVPRPRPES
WSEQGPSDFEVEWSNEPTFSLTVKRRETGDILFSTEGTVLVYEDQFVEFVSSLPENYNLY
GLGTLYAADVADNIDANIYGTHPIYLDTRYFEVNEEGYMTYTPYAAATDRTTSYVSYTHG
VFLRNAHAQEVLLTSEGITWRTLGGSIDLYFFSGPTADAVIQSYQRTAIGFPAAQQYWTL
GFHQCRWGYENWTVVQEVVENFSRFEIPLEAIWTDIDYMNKYRDFENDPQRYSYEEGAEF
LDRLHSNGQHYIPIIDSAIYVPNPENPEDAYPTYDRGVKASAFLLNPDGSIYYGAVWPGY
TDWVGAVLNGTGTIDWWIEELSIWSEKVAVASFCVGSCGTGNLTLNPVHPPFVLPGEPGN
PILEYPEGFELTNSSEAASASAAKHSRTAAAKPTSTTKTSSYLRTTPTLGVRNVNWPPYT
INNFHGDLAVHAVSPNATHHGGYLQYDFHNLFGHQILNATYQALLKIKPGKRPFIIGRST
FPGSGKWAGHWGGDNESRWALMYFSIPQALSFSIFGIPMFGVDTCGFGGNADAELCSRWM
QLSAFFPFYRNHNILGARSQEPYVWSSVAEASRRAMRIRYMLLPYLYTLMMQASLDGSTV
MRALAWEFPNEPWLADADRQFMLGSAVMVTPCLEQGATTVKGVFPGVRDGKTVWYDWYTG
RKASEGVRPGENITIDAPLGHIPVFLRGGSVVPVQEPGMTTTESRSKPWGLIVALDWHEF
AEGVLYLDDGESLMPQEVTWVKFSASTGSLIVQPAGTYVDINPLANVTVLGVKNKPHKMW
LDGQDVEPGYWRYREEKETLELRGLEALFMEGAWKKTWELRWE
NT seq 3192 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtacttaccccatcactatcagctgttggcacagagccagctggcaatattttg
aactcatcagtcctcaagcctgtcggtcgctctctcagtcacacaatactccagtcctat
gctgacagggtgtcttcatcatcgagtttttcgaggttaccctgctccttggtcacaacc
aaggccataaggctcatgaagccgctcatcgttctgatcattggcattcgggtggtattt
gccgaagcggctagggaggccagcattgaggcagaggtcaagccaacaatttgggcaaac
atccacaagtcaaatccggtgtcatcggtcaaggagaaatttctctcgggttggagacgg
aaaatcttccaactcgacgacatagagtccttaaactcacttgcatttgaggttgatacg
ggccagaatgtgctgccgaacatcaaagatccagaagccatcaatccgcaagctatttgc
cccgggtacaaggccgcagatgttcgctatacacaagacggaagcttcacagcaagcctg
caccttgcaggaaagccgtgtaatttgtacggcaatgacattgagcacttgattttggag
gtcgagttccaggcttcagaccgcttgcacattgagattaagccaagatacattggtcag
gagaatgaaacatggttccttctcccagatgtgctggttccgcgtcctcggccggagtct
tggtcagagcaagggccgagtgattttgaagttgaatggtccaatgagccaactttctcg
ctcacagtgaagcgtcgggagacaggggacatcctgttctcaacagagggaacagtacta
gtctacgaggaccagttcgtagaatttgtgagctcgctgcctgagaattacaatctttat
ggactgggaacgctttatgccgccgatgtggcagacaacatcgacgcaaacatatatgga
actcaccctatctacctcgatacccggtattttgaagtaaatgaggagggctacatgacc
tatacaccctatgcagctgcaacagacaggacaaccagctatgtgtcctacacccatggt
gtattcctccggaatgcccacgcacaagaggtcctcttgacatccgagggcatcacatgg
cgaaccctgggtggtagcatcgacttatatttcttcagcgggcccacggcagatgccgtc
atccagtcataccagcgaactgcaatcgggttccctgccgcacagcaatactggactttg
ggctttcatcaatgcaggtggggttatgagaattggaccgttgtacaggaagtcgtggaa
aacttttccaggtttgaaattcccctggaggcgatctggaccgacattgattatatgaac
aagtaccgtgactttgaaaatgatcctcagagatacagctacgaagaaggggcggagttc
ctggatcgattgcattccaatggccaacattacataccgattatcgactcggccatctat
gttccgaacccggaaaatccagaggatgcttatccgacatatgatcgaggtgtgaaggcc
agtgccttcctgctgaatccggatggttccatttactacggagcagtatggcctggatac
accgactgggtcggtgccgtcttgaacggaacgggcactattgactggtggatcgaagaa
ttatcgatttggtcggagaaggttgctgttgcttcgttctgcgtgggaagttgcggtact
ggaaacctcacgctcaacccggttcaccctccctttgtactacctggagagccgggaaat
ccgatcttggaatacccagaggggttcgagctcactaattcctcagaggcagcgtcagct
tcagcagccaagcattctcgcactgcagcggctaagccaaccagcacgaccaagacgtct
agctaccttcgaaccactccaactcttggggtgcggaatgtcaactggccaccatataca
atcaataactttcacggcgatctggctgtacatgcggtcagtcctaatgcaactcatcac
ggaggatacctccaatacgattttcataacctctttggacatcagattctgaatgccacc
taccaagctctactcaaaatcaagcctggcaagcgacctttcatcatcggccgtagcaca
tttccaggatcgggcaagtgggcaggacactggggcggagacaatgaatccaggtgggcg
ttaatgtacttctctattccgcaagctctgtccttctcaatttttggcatccccatgttt
ggggtcgacacgtgtggcttcggtggcaacgccgacgcagagctctgctcgcggtggatg
caattgagtgccttcttccccttttaccggaaccacaacatcctgggcgcccgaagtcag
gaaccatatgtatggagcagcgtcgctgaggccagccgtcgcgctatgcgtatccgttac
atgctattgccatatctctacacccttatgatgcaggcgagcttggacgggagcaccgtc
atgcgagccttggcctgggagttccccaatgaaccctggctcgcggacgcagaccggcag
ttcatgctcggaagcgcagtaatggtgacgccgtgcttggagcagggggctaccacagtc
aagggtgtgttccctggtgttcgagacggaaagactgtttggtatgactggtacacgggg
aggaaggcctcggaaggggtccgaccgggcgaaaacatcactattgatgcacccctcggg
cacatacctgtcttcttgaggggaggcagcgtggttcctgtgcaggagcccggcatgacg
acgacagaaagcaggagcaagccatgggggttgattgtggccttggattggcacgagttt
gcggaaggcgtgctgtatttggatgatggggaaagtctgatgccacaagaagtgacgtgg
gtcaagttctctgcctccacgggctcccttatcgttcagcctgcgggcacatacgttgat
attaacccgcttgcgaatgtcactgtcttgggggtaaaaaataagccccacaagatgtgg
ctagatgggcaggacgttgaacccgggtactggagatatagagaggaaaaggagacgttg
gagctgcgaggtctggaggccttgtttatggagggggcttggaagaagacatgggagctt
cggtgggagtga

DBGET integrated database retrieval system