KEGG   Chlamydia trachomatis RC-J(s)/122: CTRC122_03885Help
Entry
CTRC122_03885     CDS       T02770                                 

Definition
(GenBank) biotin--protein ligase
  KO
K03524  BirA family transcriptional regulator, biotin operon repressor / biotin---[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]
Organism
ctjs  Chlamydia trachomatis RC-J(s)/122
Pathway
ctjs00780  Biotin metabolism
ctjs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctjs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CTRC122_03885
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ctjs03000]
    CTRC122_03885
Enzymes [BR:ctjs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     CTRC122_03885
Transcription factors [BR:ctjs03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    CTRC122_03885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPL_LplA_LipB
Motif
Other DBs
NCBI-ProteinID: AGS00683
LinkDB All DBs
Position
839900..840454
Genome map
AA seq 184 aa AA seqDB search
MKEIYYEIARTESTNTTAKEGLSLWDPYALTVITTREQTAGRGKFGRVWHSTDQDLLASF
CFFLSVNNVDSALLFRIGTEAVMRLGESLGIQEAVMKWPNDVLVQGKKLSGVLCETIPVK
TGTCVIIGIGVNGNVGADELLGIDQPATSLQELIGRPVDMEEQLKRLTKEIKHLIQTLPL
WGRE
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaatctattatgaaatagcacgtacggaatcaacgaatacgacagcaaaagag
gggctttctttgtgggatccctatgctctcacagtgatcacgaccagagaacaaacggcg
ggaagagggaaatttggaagggtctggcactccacagatcaagatcttttggcttcgttt
tgtttctttttaagtgtgaataatgtggacagtgctttgttatttcgtatagggacagaa
gccgtgatgcgtctcggggaatcgttaggcattcaagaagctgtcatgaaatggcctaac
gacgtgttagttcaggggaaaaaactttcaggagtgttgtgtgagaccatccctgttaag
actggaacgtgtgtcattattggtatcggtgtgaatggtaatgtgggtgctgatgaattg
ctaggtattgatcagcctgcaacgtctctccaggaattgatagggaggcctgtagatatg
gaagaacagcttaagcggctcacgaaagaaatcaagcatcttatccagacgctaccgtta
tgggggcgagaataa

DBGET integrated database retrieval system