KEGG   Chlamydia trachomatis E/150: E150_01530Help
Entry
E150_01530        CDS       T01903                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ctk  Chlamydia trachomatis E/150
Brite
Enzymes [BR:ctk01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     E150_01530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Imm3
Motif
Other DBs
NCBI-ProteinID: ADH17062
LinkDB All DBs
Position
complement(327848..328468)
Genome map
AA seq 206 aa AA seqDB search
MVFSSYMLPALPYDYDALEPVISAEIMQLHHQKHHQGYINNLNEALKSLDVANATQDLTR
LIAINPALRFNGGSHINHSLFWEMLAPQGKGGGVPPRHELLKLIEKFWGSFDNFLKNFIT
SSAAVQGSGWGWLAFCPQKQELMVQTTANQDPLEATTGMIPLLGVDVWEHAYYLQYKNAR
MGYLKSFPSIINWDYIENRFVEMSKQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggtcttttcttcttatatgcttcccgcattgccttatgattacgatgctttagagcct
gtaattagtgctgagattatgcaactgcatcatcaaaagcatcaccaaggatatataaat
aatttgaatgaggccttaaaaagtttagatgtagcaaacgctactcaagatttaacaagg
ttaatcgcaatcaatcctgctctgcgtttcaatggtggaagccatattaaccactctctt
ttctgggagatgcttgcgcctcaagggaaaggggggggagttcctcctcgtcatgaattg
ttaaaattaatcgaaaaattctggggctctttcgataactttttaaaaaattttattact
tcttctgctgcggtgcaaggatctggctggggatggttagctttttgtccccaaaaacaa
gagcttatggtacagactacagcaaaccaggatcctctggaggcgacgactgggatgatc
cctctcctaggagtagatgtgtgggagcacgcatattatctccagtataaaaatgcgaga
atgggctatctaaaaagtttccccagcataattaattgggattatatagagaatcgcttt
gtagaaatgagcaagcaataa

DBGET integrated database retrieval system