KEGG   Hungateiclostridium thermocellum DSM 1313: Clo1313_2637Help
Entry
Clo1313_2637      CDS       T01933                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ctx  Hungateiclostridium thermocellum DSM 1313
Brite
KEGG Orthology (KO) [BR:ctx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Clo1313_2637
Enzymes [BR:ctx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Clo1313_2637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like Thi4 FAD_oxidored DAO AlaDh_PNT_C Glutaredoxin K_oxygenase FAD_binding_3 Thioredoxin_4 NAD_binding_8 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ADU75636
LinkDB All DBs
Position
complement(3104643..3106172)
Genome map
AA seq 509 aa AA seqDB search
MFLDAEIMQQLEQYLTLLENDIVIKVNAGNDKVSVDMVRLIDEIAKLTPKIHVEKAELDR
TPSFSVNRPNEDTGIVFAGIPLGHEFNSLVLALLQVGGRAPKVDEALINQIKGIKGEYHF
ETYVSLSCHNCPDVVQALNIMSVLNPNITHTMIDGAVFREEVESKGIMAVPTIYLNGNFF
ESGRLTLEEILAKLGQATESPSINEKEPFDVLVIGGGPAGVSSAIYAARKGLRTGIIAER
FGGQILDTLGIENFISVPYTEGPKLAENFKEHVKRYDIDVMERQRAKSIRRNELLEVELE
KGAVVKSKTVIIATGARWRNVNVPGEKEFKNKGVAYCPHCDGPLFAGKDVAVIGGGNSGI
EAAIDLAGIVRHVTVLEFLPQLKADKVLQERLYRLPNVTVLTNVQTKEFTGKEKLDGITY
IERDTNQEKHIEVQGVFVQIGLVPNTEWLEGTIERNAMGEIIVNEKNETSMPGVFAAGDC
TNSPYKQIVIAMGSGATAALSAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtttttggacgcggaaatcatgcagcaactggaacagtatttgacgttgctggaaaat
gatattgttatcaaggttaacgccggaaacgataaagtatccgttgatatggtcaggcta
atagatgaaattgcaaaacttacgccaaagattcacgttgaaaaagcagaactcgacaga
acaccaagctttagcgttaaccgtccgaatgaggatacgggtattgtctttgccggtatt
ccgttgggtcatgaattcaactccttagttttggctctcctccaggtaggaggaagagcc
cctaaggtggatgaggctctcatcaatcagattaagggaattaaaggagaatatcatttt
gaaacttacgtcagcctaagctgccataattgccctgatgttgtccaggcacttaacata
atgagcgtactcaatcctaatatcacccataccatgatcgacggagcagtcttcagagaa
gaggttgaaagcaagggcataatggcggtgcctacgatatacttaaatggaaatttcttc
gaaagcggccgattgacgctggaagaaattcttgcaaaactggggcaggcgacggaaagt
ccatccattaatgaaaaagagccttttgacgttcttgtcataggcggaggacctgccggc
gtaagttctgccatctatgctgcccggaaaggacttcgtaccggtattatagctgaaaga
tttggagggcagattttagataccttgggaattgagaattttatctcagttccatacacc
gaaggtcccaagcttgccgaaaatttcaaggagcatgttaaaaggtatgacatagatgta
atggagcgtcaaagggcaaaaagtataagacgcaatgaacttttggaagtagagctggaa
aagggagctgttgttaaaagtaagacggttattattgcaacgggggcgagatggcgcaat
gtgaacgttcccggagagaaagagtttaaaaacaaaggcgtggcttattgcccccactgc
gacggaccgctgtttgcagggaaggatgtggccgtaattggcggaggcaattccggtata
gaagctgccattgatttggcgggcattgtaagacacgtaacggtactggaatttctgccg
cagctgaaagctgacaaagtgcttcaggaacgtttgtacaggcttcccaatgtaactgtg
cttacaaatgtccagacaaaagagtttaccgggaaggaaaagctcgacgggattacttac
attgagcgtgacactaatcaagaaaagcacattgaggttcagggagtgtttgttcagatt
ggccttgtcccaaataccgaatggctggaaggaaccattgaacgcaatgccatgggtgaa
attattgtcaatgaaaaaaatgaaacctcaatgcccggggtatttgcagcaggtgactgt
accaacagcccctataaacagattgttatagccatgggttccggtgcgacggccgcactc
agcgctttcgattacctaatcaggaattaa

DBGET integrated database retrieval system