KEGG   Chlamydia trachomatis A2497: CTR_2891Help
Entry
CTR_2891          CDS       T01707                                 

Gene name
sodM
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cty  Chlamydia trachomatis A2497
Brite
Enzymes [BR:cty01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CTR_2891 (sodM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAX08956
LinkDB All DBs
Position
complement(329552..330172)
Genome map
AA seq 206 aa AA seqDB search
MVFSSYMLPALPYDYDALEPVISAEIMQLHHQKHHQGYINNLNEALKSLDVANATQDLAR
LIAINPALRFNGGSHINHSLFWEMLAPQGKGGGVPPRHELLKLIEKFWGSFDNFLKNFIT
SSAAVQGSGWGWLAFCPQKQELMVQTTANQDPLEATTGMIPLLGVDVWEHAYYLQYKNAR
MDYLKNFPSIINWDYIENRFVEMSKQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggtcttttcttcttatatgcttcccgcattgccttatgattacgatgctttagagcct
gtaattagtgctgagattatgcaactgcatcatcaaaagcatcaccaaggatatataaat
aatttgaatgaggccttaaaaagtttagatgtagcaaacgctactcaagatttagcaagg
ttaatcgcaatcaatcctgctctgcgtttcaatggtggaagccatattaaccactctctt
ttctgggagatgcttgcgcctcaagggaaaggagggggagttcctcctcgtcatgaattg
ttaaaattaatcgaaaaattctggggctctttcgataactttttaaaaaattttattact
tcttctgctgcggtgcaaggatctggctggggatggttagctttttgtccccaaaaacaa
gagcttatggtacagactacagcaaaccaggatcctctggaggcgacgactgggatgatc
cctctcctaggagtagatgtgtgggagcacgcatattatctccagtataaaaatgcgaga
atggactatctaaaaaatttccccagcataattaattgggattatatagagaatcgcttt
gtagaaatgagcaagcaataa

DBGET integrated database retrieval system