KEGG   Curtobacterium sp. BH-2-1-1: BJK06_07050Help
Entry
BJK06_07050       CDS       T04562                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
cub  Curtobacterium sp. BH-2-1-1
Pathway
cub00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BJK06_07050
Enzymes [BR:cub01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BJK06_07050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14 Glyco_hydro_35 AvrLm4-7 Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: AOX67610
LinkDB All DBs
Position
complement(1512133..1514151)
Genome map
AA seq 672 aa AA seqDB search
MPTAATGALGLGSTGLAFGCDYNPEQWDPEVWVEDVRLMREAGVNLVAINVFGWSHVEPR
RGEYDFAALDRVIELLHGAGIGVDLGTGTASTPPWLTTAHPEVLPVVADGTTRWPGGRQA
FCPSSPVYREHALALVRATAERYGDHPAVKLWHVSNELGCHNAHCYCDVSAEAFRTWLRA
RYGTVDELNAAWGTAFWSQRYSAWEQVLPPRATLSFTNPGQTLDFDRFSSDELLAHHRAE
AEVLRSLSDKPVTTNFMVAAHITALDYWSWTADMDVIANDHYLDHRLPRPHVELAFAADT
TRGLAGGAPWLLMEHSTGAVNWQPHNVAKAPGEMLRNTVAHIARGADGVCFFQWRASVQG
SEKFHSALLPHAGTDSRGWRDVVELGDLVERLGELRGSRVVADVALVFSWENQWAADLEA
HPTTALRYLEQVHAFHGALWDLGVTVDVVAPGAPLDGYAVVLVPELYLVRDEHAAVVADH
VAAGGRAVVTFFSGIVDERDRVRTGGYPGAFRDLLGVRVDEFLPLAADARIALSDGSNGT
VWSEPVELRGATSVLDYAAGQLAGSPAVTRNAHGAGAAWYVSTVLAADTLRGLLGDVLAE
AGVAPDPTAQPGLEVVRRRDDQHEWVFLLNHTDQPVEHHVTGHDLVADRPRTGTTTIAPG
GTQIIRTDRKRP
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
ctgccgacggccgccaccggcgcgctcgggctcggctcgaccggtttggcgttcgggtgc
gactacaaccccgagcagtgggaccccgaggtctgggtcgaggacgtccggctcatgcgc
gaggccggcgtgaacctcgtcgcgatcaacgtcttcggctggtcgcacgtcgagccgcgc
cggggcgagtacgacttcgccgcgctcgaccgggtcatcgagctcctgcacggcgccggc
atcggggtcgacctcggcaccgggacggcctccaccccgccgtggctcaccaccgcccac
cccgaggtcctgccggtcgtcgccgacggcaccacgcgctggcccggtggacgccaggcg
ttctgcccgagctcgccggtgtaccgcgagcacgccctcgccctggtccgcgccaccgcc
gagcgctacggcgaccaccccgcggtcaagctctggcacgtctcgaacgagctcggctgc
cacaacgcgcactgctactgcgacgtctccgccgaggcgttccgcacgtggctccgcgcc
cggtacggcaccgtcgacgagctcaacgccgcgtggggcaccgcgttctggagccagcgc
tactccgcgtgggagcaggtcctgccgccccgggcgaccctgtccttcacgaaccccggc
cagacgctcgacttcgaccggttctcgtccgacgagctgctcgcgcaccaccgcgccgag
gccgaggtgctccgcagtctgagcgacaagccggtgacgacgaacttcatggtcgcggcg
cacatcacagcgcttgactactggtcgtggacggcggacatggacgtcatcgcgaacgac
cactacctcgaccatcgtctgccccgaccgcacgtcgagctcgccttcgccgccgacacc
acgcgcgggctcgcgggcggggcgccctggctgctcatggagcactcgacgggagcggtg
aactggcagccgcacaacgtcgccaaggcgccgggggagatgctccggaacaccgtggcg
cacatcgcccgcggtgccgacggggtctgcttcttccagtggcgcgcgtccgtccagggc
agcgagaagttccactccgcgctgctcccgcacgccgggaccgactcccgcggctggcgt
gacgtcgtcgagctcggcgacctggtcgagcggctcggcgaactgcgcggttcccgcgtc
gtcgcggacgtcgcgctcgtcttcagctgggagaaccagtgggcggccgacctggaggcg
caccccaccaccgcgctccgctacctggaacaggtccacgcgttccacggcgcgctgtgg
gacctcggcgtgacggtggacgtggtggcaccgggtgcgccgctcgacggctacgccgtc
gtgctcgtcccggagctctacctggtgcgcgacgagcacgccgcggtcgtcgccgaccac
gtcgccgccgggggtcgggcggtcgtcacgttcttcagcgggatcgtcgacgagcgtgac
cgcgtgcggaccggcgggtaccccggtgccttccgtgacctgctcggcgtgcgggtcgac
gagttcctgccgctcgccgccgacgcgcgcatcgccctgtccgacggctccaacggcacc
gtctggagcgaacccgtcgagctccgcggcgcgacgagcgtgctcgactacgccgccggc
cagctcgccggctcgcccgcggtcacccgcaacgcgcacggtgccggagccgcctggtac
gtctccaccgtcctcgccgccgacacgctccgcggcctgctcggtgacgtcctcgccgag
gccggcgtcgcaccggaccccaccgcgcagcccggcctcgaggtcgtccgacgccgcgac
gaccagcacgagtgggtgttcctgctcaaccacaccgaccagcccgtcgagcaccacgtg
acgggccacgacctcgtcgccgaccgaccccggaccggcaccacgaccatcgcccccggt
ggcacccagatcatccgcacggacaggaagcgcccatga

DBGET integrated database retrieval system