KEGG   Corynebacterium ulcerans 0102: CULC0102_0044Help
Entry
CULC0102_0044     CDS       T02171                                 

Gene name
pknB
Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cue  Corynebacterium ulcerans 0102
Brite
KEGG Orthology (KO) [BR:cue00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cue01001]
    CULC0102_0044 (pknB)
Enzymes [BR:cue01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CULC0102_0044 (pknB)
Protein kinases [BR:cue01001]
 Serine/threonine kinases: Other
  Bacterial family
   CULC0102_0044 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Pkinase_fungal Kdo Seadorna_VP7 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: BAM26244
LinkDB All DBs
Position
complement(44374..46368)
Genome map
AA seq 664 aa AA seqDB search
MNDVIAGRYELGEVIGTGGMSEVYSATDTLLGREVAIKMLRADLARDVNFRERFRREAQN
SGKLNHPAIVAVYDTGETERAGISTPYIVMERVHGRTLRDIVREDGPLSPTEAAQTLLPV
CQALQFSHDAGIIHRDIKPANVMITNTGTVKIMDFGIARALDDATNAMTQTSAVIGTAQY
LSPEQARGKLADARSDVYALGCVLYETLTGRPPFEGETPFAVAYQHVQEDPAKPSEFVSD
LTPTAAVNVDAVVLTAMAKHPGDRYQTAMDMGADLERLARHAVTEAARHYVSPASLISQE
PNPTTIVPITQLDQPGPASAAPHSEVDGYEHSAFAGPAHAAEEERSGMSKAMKAALAVLA
VLVLGVGGAFAYDFVSNSSKNRSLVNIPKLEKSSQQDAVNQLEQLGLQVNVIEEANPDVP
RGKVIRTNPTSGSSVQKNTTVTVVVSSGKEVTEVPDLARKNTADAAKILEEAGLQLDSTV
REESSDSVPNGEIIEQTPSAGSQVSRGSKVVITVSTGVQNVRVPVVTGMKWDQAEGNLTS
LGFVPDVRTVDAPEPAGTVVGVSDEGTEIPKGSTVTVKVSNGQMFNVPNITRLTVADAVR
ALNAAGWTGTASKLTQGERVPTVSLSDQNLIASQVPTAGTPLRKDAPIEIHLYEFSLSAL
TNPR
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatgtgattgctggccgctatgagcttggtgaggtcatcggcacgggtggaatg
tcagaggtgtactctgccaccgataccctccttggccgcgaagtcgcgataaagatgctg
cgcgcggaccttgcgcgcgatgtaaacttccgcgagcggttccgtcgagaagcccaaaac
tccggcaagttgaatcaccccgcgatcgttgcggtgtatgacactggtgagaccgaacgc
gctggcatcagcacgccttatatcgtgatggaacgcgtgcacggccggaccctccgcgac
atcgtgagggaagacgggccgctttctccgacggaagccgcacaaaccttgcttccggta
tgccaggcgctgcaatttagccatgacgctgggattatccaccgcgacattaagcccgcg
aacgtgatgatcaccaataccggcactgtaaaaatcatggacttcggcatcgcccgtgcg
cttgacgacgccaccaacgccatgacccagacctccgcagtgatcggcaccgcccagtat
ctgtccccggaacaagcccgtggcaagcttgccgacgctcgctccgatgtctacgcactg
ggctgcgtgctttatgagacgcttacgggacgccctccttttgaaggggaaacgcctttc
gccgtcgcatatcagcatgtccaagaggatccggcaaaacccagcgagtttgtttctgat
ctcacccccactgctgcagtaaacgtggatgctgtcgtccttactgcgatggcaaaacac
cccggtgatcgttatcaaacggctatggacatgggggcggatctcgagcgcttggctcgc
catgcagtaacagaagcggctcgtcactatgtttctccagcgagtctgatcagccaggag
cctaatcccaccaccatcgtcccgattacccagcttgatcagccgggtcctgcatcagca
gcgcctcactcagaggtcgacggatacgagcactctgcttttgctggcccggctcatgct
gcggaagaagagcgctccggtatgagcaaggcgatgaaggccgctctcgcggttcttgcc
gtgctagttcttggtgtaggtggtgcttttgcctatgattttgtgagcaacagcagcaag
aatagatctcttgtcaacattcctaagctggaaaagtcttctcaacaagatgctgtgaac
cagctagagcagcttggcctacaggtcaatgtgatcgaagaggcgaacccagatgttccg
cgaggaaaagtcattaggacaaaccccaccagcggatcctcagtacaaaagaacaccact
gtcacggtagtcgtctcttctggcaaggaagtcacggaagtccctgatcttgcacgcaag
aacaccgcggatgccgcgaagattcttgaagaagccggccttcagctggattcgactgtg
cgcgaggaaagctcagatagtgttcccaacggggaaatcatagagcagacaccaagtgct
ggttcgcaggtttcccgaggatcaaaagtggtcatcactgtgtctaccggggtgcaaaac
gtccgcgtcccagtagtgacgggtatgaagtgggatcaggcagaaggcaacctcacatcc
ttgggatttgttcctgatgtacgtactgtcgacgctcccgagccagccggtaccgttgtt
ggtgtctcagacgaaggcactgagatacctaaaggctcaacggtcacagtcaaggtgtcc
aacggccagatgtttaatgtccccaacatcacccggctcaccgtcgctgatgctgtgaga
gcactcaacgctgcaggatggacaggaactgcatctaagctcacgcaaggtgaacgagtg
cctacggtgtctttgtccgatcagaatttgatcgcgtcccaggtgccgactgccggcaca
ccactacgaaaagacgccccgatagaaattcatctctatgaattcagtctctcggctctt
accaacccgcgctag

DBGET integrated database retrieval system