KEGG   Corynebacterium ulcerans 0102: CULC0102_1334Help
Entry
CULC0102_1334     CDS       T02171                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
cue00620  Pyruvate metabolism
cue00680  Methane metabolism
cue01100  Metabolic pathways
cue01120  Microbial metabolism in diverse environments
cue01200  Carbon metabolism
Module
cue_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cue00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CULC0102_1334 (ppc)
  Energy metabolism
   00680 Methane metabolism
    CULC0102_1334 (ppc)
Enzymes [BR:cue01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CULC0102_1334 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAM27533
LinkDB All DBs
Position
complement(1424367..1427186)
Genome map
AA seq 939 aa AA seqDB search
MPVKATSAGPLSEQLVEDIRFLGALLGEVIKEQEGTAAFDRVEAARQLAFKISRKEAQVE
DLVSLLKDISAADAISIIRAFSHFALLANMVEDLHDELGRLRRQETGEEDPDSTLGATWK
KLAKAGVTSEDVSGLLGNFQVAPVLTAHPTETRRRTIFDAQEHMTTLLKERHTILSADPN
ALTATRLEENTRRIRRWLTLIWQTALIRVARPRIEDEVEVGLRYYKLSLLTAIPEINKQV
ADHIQREYGVSSEDALRSLFIKPGSWIGGDHDGNPYVTAETLHYATTRAAETVLKFYARE
LHQLEHELSLSDRLTDVSPTLRVLADLGHNDVPSRVDEPYRRAVHGVRGRVLATLASRIG
TEAVEGSWYARHDAYSDPDELAADLDVIDASLRRTHDELIADDRLLRIRTAVSSFGFHLY
SMDLRQNSESYEDVLTELFEQAHVTKHYRELDENEKIRVLTAELSSPRPLIPRDGASYSE
VTQRELDIIAEAKRAVDAFGAMMIPHSIISMAESASDILEPMVLLKEFGLIRIQEGQLTG
HIDVIPLFETIDDLQNGAKILQDLWRIPLYRSYVEQRNNLQEVMLGYSDSNKDGGYLAAN
WALYAAETDLVSMCKQHGVALRLFHGRGGTVGRGGGPSYDAILAQPHGAVQGSVRVTEQG
EIISAKYGSVGAARRNLEALASATLEASLLTIDQVEEQYPEAYEIMGEISRLSQRKYSRL
AHEDPGFIEYFTSSTPLEEIGDLNIGSRPSSRKQTQSIDDLRAIPWVLSWSQSRVMLPGW
YGVGSALHEWVEKGCVRTAELSADERLAILQKLNDSWPFFSSVLSNMAQVMSKAEMQLAK
LYSGLVADQEAANRIFADISAEFDLTKTMFLKITGFSGLLDDNPMLARSVRSRYPYLLPL
NTLQLEMLRRYREGDTDPKVVHGIRLAMNGLATALRNSG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaaaagctacgtctgcaggtccactatccgaacagcttgttgaggatatacgc
tttctaggtgcacttttgggggaggtgatcaaagaacaagagggaacggcagcctttgac
cgagtcgaagcagcgcgacagctggcttttaaaatctcgcgcaaagaggcacaggttgaa
gacttagtatcactgctcaaagatatttcagcagcagatgcgatatcgattattagagcg
tttagccattttgcgttgctagcaaacatggtggaggacttgcacgatgaactgggtaga
ctccggcgacaagaaaccggtgaagaagacccagattcaactttgggtgcgacctggaaa
aagcttgctaaggctggagtaacgagcgaagacgtgtccggtttactcggtaactttcaa
gttgccccggtgcttaccgctcaccctacggaaacccgtagacgtacgatttttgatgcg
caagagcatatgactactttgctcaaagaacgtcatacgattctgagcgcagatccgaat
gcgctgacggctacgcgtcttgaagagaatactcgtcggattcgccggtggttgactctc
atctggcagaccgcgcttatccgggtggcccgccctaggattgaggacgaggtagaagtt
ggattgcgatactataagctctccttgcttactgcgatccctgagatcaacaagcaagtg
gctgatcatatccagcgagaatatggtgttagctctgaagatgctttgcggtcgctattc
attaaacctggaagctggatcggtggcgaccatgacggtaacccgtatgtcactgcggaa
actctgcactatgcgacgacacgagcagccgagactgtattaaagttttatgcacgcgaa
ctgcatcaacttgaacatgagttatcgctgtcggataggttgactgatgtgagcccgact
ctgcgcgtgcttgctgatttaggacataacgacgtcccatcgcgggtcgacgagccttat
cgccgtgccgtccacggtgtgcgcggtagagtacttgctacgctagcttctcggattggt
acagaagcggtagaaggctcgtggtatgcccgtcatgatgcttattctgatccagatgag
cttgcagcagatttggatgtcattgatgcttccttgcggagaacgcacgatgaactcatc
gcagatgatcgcttgttgcgcatcaggacagcggtatcaagctttggtttccatctctat
tcgatggatttgcgccaaaattctgagagctatgaggatgtgcttaccgagctctttgag
caagcccacgtaaccaagcactatcgcgaattggacgagaacgaaaagattcgcgtttta
actgctgagctatcgtcaccgagaccccttataccgcgcgatggtgcgtcatatagtgag
gtaacccagcgtgagctcgacattattgctgaggcaaagcgtgcagtagatgcttttggt
gcaatgatgatcccacattcgattatctcgatggcagaatctgcgagcgatatcctcgaa
ccgatggtcctcctgaaagaattcggattaatccgcattcaggaaggacaacttaccgga
cacattgacgtcataccgctttttgaaacgatcgatgatctgcaaaatggtgccaagatt
ctccaagatctatggcggataccgttgtatcgcagttatgtggagcaacgaaataatctt
caagaggtcatgcttggctattccgattccaataaagatggtggctatctcgccgcaaac
tgggctctgtatgctgccgaaactgatttagtaagcatgtgtaaacaacatggtgtagcg
ctgaggcttttccatggccgcggtggaaccgtaggacgcggcggcggcccctcttatgac
gctatccttgctcagccacatggtgctgtgcaaggcagtgtacgtgttacagaacaaggt
gagatcatctcagcaaaatatggttctgtgggtgcggctcgtcgtaacctagaagccttg
gcctcagccacgctggaggcgtcgctgcttacaatcgatcaggtagaagagcaatatcct
gaggcgtatgagattatgggtgaaatctcacgcttgagtcagcgaaagtattcgaggctt
gcgcatgaagaccctggatttattgagtacttcacatcctccacacctttggaagagata
ggcgaccttaacatcggctcgcgtccttcgtcgcgaaaacaaacccaaagtatcgacgat
ttacgcgcaattccatgggtgctcagttggtcccagtcccgtgttatgctgcccggctgg
tatggagtaggcagcgctttgcatgaatgggtagaaaaaggctgtgtgcgcacagcggaa
ctctcagcagatgagcgccttgctattttgcagaagcttaatgattcttggccgttcttt
tcttctgtgctgtctaatatggcgcaggtgatgagcaaagctgagatgcaacttgcgaag
ctctattcgggattggtagcagatcaggaagccgcaaacagaatatttgctgatatttct
gccgaattcgatctcactaagacgatgttcctcaagatcaccggcttctcggggcttctc
gacgacaacccgatgcttgcacggtcagttcgctcgcgttacccgtatctgttgccgctt
aatacactgcaactcgaaatgctacgtaggtatcgcgaaggtgatactgatccgaaggtg
gtgcatggcattcgcctagctatgaacggcttggctaccgcgctgcgaaattctggctag

DBGET integrated database retrieval system