KEGG   Cupriavidus sp. USMAA1020: BKK80_21315Help
Entry
BKK80_21315       CDS       T04978                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cup  Cupriavidus sp. USMAA1020
Pathway
cup00250  Alanine, aspartate and glutamate metabolism
cup00410  beta-Alanine metabolism
cup00640  Propanoate metabolism
cup00650  Butanoate metabolism
cup01100  Metabolic pathways
cup01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cup00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BKK80_21315
   00650 Butanoate metabolism
    BKK80_21315
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BKK80_21315
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BKK80_21315
Enzymes [BR:cup01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BKK80_21315
Amino acid related enzymes [BR:cup01007]
 Aminotransferase (transaminase)
  Class III
   BKK80_21315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOZ08497
LinkDB All DBs
Position
2:319168..320430
Genome map
AA seq 420 aa AA seqDB search
MRNADLVRRKDAATPRGVGVMCNFYAERADNAEIWDVEGKRYIDFAAGIAVLNTGHRHPR
LLQAMQEQMARFTHTAYQIVPYASYVELAEKINARAPGRFAKKTAFFTTGAEAVENAIKI
ARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKVGFGPFPGEIFHAPYPCELHGVSVE
DSLKALQQLFKSDIDPKRVAAIIFEPVQGEGGFHVAPAAFVKALRALCNEHGILLVADEV
QTGFGRTGKLFAMEHYGVAPDLTTMAKSLAGGMPLSAVCGRAELMDAPAPGGLGGTYAGN
PLAVASALAVLEVLEQEKLVDRGAVLGDRLRDKLEGLRSRVPQIAQVRGVGAMIAVEFKQ
ADGSPDPDFTRQVQARALERGLLLLSCGVDGNVIRFLFPLTIPDAVMDEALGILADALLG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatgcagacctggttcgccgcaaggacgccgccaccccgcgcggcgtcggcgtg
atgtgcaatttctacgccgagcgggccgacaatgccgagatctgggacgtcgagggcaag
cgctacatcgacttcgccgccggcatcgccgtgctgaacacgggccatcgccacccgcgc
ctgctgcaggcgatgcaggagcagatggcgcgcttcacccacaccgcctaccagatcgtg
ccctacgccagctacgtggagctggccgagaagatcaatgcgcgcgcgcccggccgcttc
gccaagaagacggccttcttcaccactggcgcggaggccgtggagaacgccatcaagatc
gcccgcgcagccaccggccgccccggcgtgatcgccttctccggcggcttccacggccgc
accatgatgggcatggcgctgaccggcaaggtggcgccctacaaggtaggcttcggcccc
ttcccgggcgagatcttccacgcgccctatccctgcgaactgcacggcgtgtcggtcgag
gactcgctgaaggcgctgcagcagctgttcaagtcggatatcgatccgaagcgcgtggcg
gccatcatcttcgagccggtgcagggcgagggcggcttccatgtggcgcccgccgccttc
gtcaaggcgctgcgcgccctctgcaacgaacacggcatcctgctggtcgccgacgaggtg
cagaccggtttcggccgcaccggcaagctgttcgccatggagcactacggcgtggcgccg
gacctcaccaccatggccaagagcctggccggcggcatgccgctgtcggccgtgtgcggg
cgcgccgaactcatggatgcaccggcgcccggcggcctgggcggcacctatgcgggcaac
ccgctggcggtggcctcggcgctggccgtgctggaggtcctggagcaagagaagctggtg
gaccgcggcgcggtgctgggcgaccgcctgcgggacaagctggaagggctgcgctcgcgc
gtgccgcagatcgcgcaggtgcgtggcgtcggcgccatgatcgcggtcgagttcaagcag
gcggacggcagcccggatcccgacttcacgcgccaggtgcaggcgcgcgcgctggagcgg
ggcctgctgctgctgtcgtgcggcgtggacggcaatgtgatccgcttcctgttcccgctc
accattcccgacgccgtgatggacgaggcgctgggcatcctcgccgacgcgctgctcggc
tga

DBGET integrated database retrieval system