KEGG   Corynebacterium uterequi: CUTER_01845Help
Entry
CUTER_01845       CDS       T03957                                 

Definition
(GenBank) glycosidase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
cut  Corynebacterium uterequi
Pathway
cut00500  Starch and sucrose metabolism
cut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CUTER_01845
Enzymes [BR:cut01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CUTER_01845
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CUTER_01845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459
Motif
Other DBs
NCBI-ProteinID: AKK10385
UniProt: A0A0G3HCG2
LinkDB All DBs
Position
complement(379306..380892)
Genome map
AA seq 528 aa AA seqDB search
MPFGGSGDGTLSAMCSTPTSPRYPRPSWLERAVFYQVYPQSFADSNGDGIGDLPGITAHL
DYLATLGITAMWINPVFDSPFKDAGYDVRDYYQLAPRYGTDADLCTLLTEAHARGIKVLF
DLVAGHTSEQHRWFIDSAQPERNAYSDRFIWTSHAFDNGDGMPFIGGETPRDATYVINFF
KSQPALNFGYRERRRPWQQPTSAPGPTANREEMAAIIRYWLERGVDGFRVDMADSLVKND
GEDKRATIACWQDIFDRVRPDFPQAAFISEWGKPWQAREAGFDLDFYLDWRGNGYNLLAR
ATEDALTRDGDVSYFNADSPTTAAVFFDAYLSQPEHLSFALISGNHDTPRLAPRLTEAER
RLFFTFLLTMPGVPFIYYGDEIGMRYRDLPSLEGGYARTGSRGPMAWDHSTPDVYLPADR
DPDAPSVAAALAAKDSLVHLVRELIALRANRPELQATPGVEVLRIDGKLVVYRRGDSVVA
INAGRTSVAVDAAGRAVIFSVGEAPRSVADGADAAAVELPPLSAAIFA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
gtgccgttcgggggttccggcgacggtacgctcagtgctatgtgcagcacccccacctca
ccgcgctacccccgcccctcctggctcgagcgggccgtgttctaccaggtgtatccccag
tccttcgcggacagcaacggcgacggcatcggcgacctgccgggcatcaccgctcacctg
gactacctcgccacgctcggcatcaccgcgatgtggatcaatcccgtcttcgactcccct
tttaaagacgccggctacgacgtccgcgattactaccagctcgcgccccgctacggcacc
gacgccgacctgtgcacactgctcaccgaagcccacgcccgcggcatcaaggtgttgttc
gacctcgtggccggacacacctccgagcagcaccgctggttcatcgactccgcacaaccg
gagcgtaacgcctactctgaccggttcatctggacctcccacgcctttgacaacggcgac
ggcatgccgttcatcggcggcgaaacgccgcgcgacgccacctatgtcatcaacttcttc
aaatcccagccggcgctcaacttcggctaccgcgagcggcgacgcccctggcagcagccc
acgtccgcgccgggtcctaccgccaaccgcgaggagatggccgccatcatccgctactgg
ctcgaacgcggggtggacggtttccgggtggacatggccgactcgctggtcaagaacgac
ggcgaggacaagcgagctaccatcgcctgctggcaggacatcttcgaccgtgtccgcccg
gactttccgcaggcggcgttcatttccgaatggggtaaaccgtggcaagcccgggaggcg
ggcttcgacctggacttctacctggactggcgcggcaacggctacaacctgctcgcccgc
gccaccgaggacgcgctcacccgcgacggcgacgtgagctacttcaacgccgactccccc
acgacggctgccgtgttcttcgatgcctacctctcccagcccgagcacttaagcttcgcg
ctgatcagcggcaaccacgacaccccacgcctggccccgcgcctgaccgaggcggaacga
cggttgttcttcacgttcctgctcaccatgccgggggtaccttttatctactacggcgac
gagatcgggatgcgctaccgggacctgccgagcctcgagggcgggtacgcccgcaccgga
tcccggggcccgatggcatgggaccacagcactcccgatgtctaccttccggcagaccgc
gaccccgacgcaccgtcggtggccgccgccctagctgccaaggactcgctcgtgcacctc
gtacgcgagctcatcgccctgcgcgcgaaccggccggagttgcaggccacgccgggggtt
gaggtgctgcgcatcgacggaaaactggtggtgtatcgccgcggcgacagtgttgttgcc
atcaacgccgggcgcacgagcgtggccgtcgacgcggccgggcgggccgtgatcttcagc
gtcggggaggcgccacgatccgtagctgacggcgccgacgcggcagccgtcgaacttccg
cccctgagcgcggctatttttgcctga

DBGET integrated database retrieval system