KEGG   Cyprinodon variegatus (sheepshead minnow): 107086189
Entry
107086189         CDS       T06110                                 

Gene name
tgfbr2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg04010  MAPK signaling pathway
cvg04060  Cytokine-cytokine receptor interaction
cvg04068  FoxO signaling pathway
cvg04144  Endocytosis
cvg04218  Cellular senescence
cvg04350  TGF-beta signaling pathway
cvg04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107086189 (tgfbr2)
   04350 TGF-beta signaling pathway
    107086189 (tgfbr2)
   04068 FoxO signaling pathway
    107086189 (tgfbr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107086189 (tgfbr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107086189 (tgfbr2)
  09143 Cell growth and death
   04218 Cellular senescence
    107086189 (tgfbr2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107086189 (tgfbr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cvg01001]
    107086189 (tgfbr2)
Enzymes [BR:cvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107086189 (tgfbr2)
Protein kinases [BR:cvg01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   107086189 (tgfbr2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase DUF4840
Other DBs
NCBI-GeneID: 107086189
NCBI-ProteinID: XP_015232459
Ensembl: ENSCVAG00000022860
UniProt: A0A3Q2DLB0
LinkDB
Position
Unknown
AA seq 542 aa
MKLLRFPVFCCGAILLGAALLPVETLGSILKIKQLCKFCDVRESSCPGKGVCQVDCEKTA
ICEHDNEVCVSIWRKDDDNTTVETVCHNPVNPLYGVILDDYNNTKCIMKEKKDMDTKFFI
CSCNDEECNENIIFNSKPLVQSPLGSALLVSLVPPLIIAIVVITSFYSYRVYRQQQNPRK
KGQPRDFSDQRAIIAEEGSDSSSQLANNLNHNTELLPIELDVLVGKGRFAEVYKAKLRQG
SSVSEEHRFETVAVKIFQYEEYASWKNEKDIFSDADLKHENVLHFLTAEERKGQRQYWLI
TAYHPLGNLQEYLTNHVISWHDMWLLGSSLASVVAHLHSERTSCGRCKVPVAHRDIKSSN
ILVKQDMTCCLCDFGLALRLDNTLSVDELANSGQVGTARYMAPEVLESRINLENIESFKQ
ADVYSMALVLWEIISRCSAIGEVQEYKPPFGNLREHPCVESMKDSVLRDRGRPEIPNSWT
SHTGIQMVCGSIEECWDHDPEARLTAQCVAERFDDIEYLDKLSDCSDSEEKLLEEIIVVD
EK
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgaagctgcttcggtttcccgttttctgctgtggagcgatcctcctcggtgctgcgctg
ctgccggtggagacgctgggatcgatattgaagataaaacaactatgcaagttttgtgat
gtgagggaaagtagctgccctggtaagggagtctgccaggtggattgtgaaaaaacagcc
atctgcgaacacgataatgaagtctgtgtcagtatttggaggaaagacgatgacaatact
acagtagaaactgtgtgtcacaatccagttaatccactgtatggtgtgattctggacgat
tataacaacaccaagtgtattatgaaagagaaaaaggacatggacacaaagttcttcatc
tgttcctgcaacgatgaagagtgtaatgagaacatcatttttaactcaaaacctttggtg
caatctccacttggatccgccctgcttgtcagcctggtgcctcctctgatcatagccatt
gttgtcatcacttccttctactcctaccgggtttaccgtcagcagcaaaacccacgtaaa
aagggtcagccgagggacttcagcgaccagcgggccatcatagctgaagaaggttcagac
agcagctcgcaactcgccaataacctgaatcacaacaccgagctgctgcccatcgagctg
gacgttctggtcggtaagggccgttttgcagaggtctacaaagccaagctgaggcagggc
tcctcagtgagcgaggagcaccgctttgagacggtggcggttaagattttccagtacgag
gagtatgcctcctggaagaacgagaaggacattttctcagacgccgacctgaagcatgag
aacgtgcttcacttcctgacagcggaggagaggaaggggcagaggcagtactggttaatc
acagcttaccatccactaggaaaccttcaagagtatctaaccaatcacgttatctcctgg
catgatatgtggcttctcgggagctcgctggcgagcgttgtggcacaccttcatagtgaa
cgcacctcctgcggccgctgcaaagttccagttgctcacagggacattaaaagctccaat
atacttgtgaaacaggacatgacctgctgcctatgtgattttggcctcgcactccggctg
gacaacactttgtctgtagatgaactggccaacagtggacaggtgggcacggccagatac
atggctcctgaggtgttggagtccagaatcaatctggaaaacattgagtctttcaagcag
gcagatgtttactcaatggctctggttctgtgggagatcatctccagatgcagtgcaatt
ggagaggtgcaggagtacaagcctccattcgggaacctgagggagcacccatgtgttgag
agcatgaaggacagcgttctccgagacagaggaagacctgagatcccaaacagctggacg
agccacacaggcatccagatggtgtgcggctctatagaggaatgttgggaccatgaccca
gaggcccgactcacagctcagtgcgttgctgagcgcttcgacgacatcgagtacctggac
aagctatcagactgctccgactcagaggagaagctcctggaggaaatcatagtcgtggat
gagaagtaa

DBGET integrated database retrieval system