KEGG   Cyprinodon variegatus (sheepshead minnow): 107093327Help
Entry
107093327         CDS       T06110                                 

Gene name
fancd2
Definition
(RefSeq) Fanconi anemia group D2 protein isoform X1
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107093327 (fancd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2 FANCI_S2 PAXNEB CCDC53 Oscp1
Motif
Other DBs
NCBI-GeneID: 107093327
NCBI-ProteinID: XP_015243808
Ensembl: ENSCVAG00000001023
LinkDB All DBs
Position
Unknown
AA seq 1455 aa AA seqDB search
MFGLYLIFPNYLIPMMRKKRRSSVEKEAGTTSTSKAKKSRRTGHQPKEVSSEETNETVFV
TFVKEAGVNLKLDGTAHEIVVDQVVFQKRIRQQLQKSPRYPGILKEFITALEAYIENPER
FKNCLFPCVPQQSEDDICSVSSFQESLLRMLLGIEMLQTLIINTLLEKIPEFMLDGAVDG
GFDFPRMIINQLKWLDRVVDPKDLAVKLMELVSVAPFEVQRDIITSLPEILEDSQHDDIA
RELNALLQENTQLTVPILDALSSLNLSSSLLTEVRDAVMATLGSVQLQDLPVVVKFILHS
VSASDASEVVNNLRKKLVLEQCVLPPVLQASQSRMKSKSTAGSASTTASGSSQDCVTLIL
DCIKSAVRFQKTISEAWLKAIESVDEVEDHKVLDLLLLFILHCTNANQSRRGAERLLKLK
VRKGLIQEALLQKTFRDYSQVLRGYFPSILALAQSLVRSPDPCVVPFGGQMHRISFTVFD
AYCQQAVVGSLVTHVCSGVGGEVDVALELLCNLVMEKPTEMALYAVFVKGILDYMDNLTP
QQIRRLFHLLSRVAFGQQQQGSHIQDDMHIVIRKQLSSTVPKYKRIGIIGAVMIVGSMGA
LRSKGKESQGGSLPQETLRQVTALLELVKSSSESSPEAAALYYDELASLIWSSSLDPQVQ
EMIGTSVLDDFQDDFVVDVGPEIAGSFPLPAFAMYNLDEEESQGCIAINLLPLLANETQN
KVDSQSGKQQKRVSPLCLSPFFRLLRLCEEKRHQGDLEEIDALLGCPLILTNMDVVDKVE
SLSKAEREFLCTLLFHTINWFREVVNAFCKQKETEMKMKVMTRLQNITFLQTLLERALAG
MSGYIPPVCNFDGETTDGMTSSFGVPVNKTKKDGTGKKRKAPGKNVPEGVSQPEEGTEAD
ETQQQDQPEKEKEKEIRPGVSLAAYRPFFRELDMEVLSVLQCGLLSRSLLDTELHTKVRE
EVLLGPTELAFLLEDMLHKVEFSLTAAPAKRAPFLKARADKTVGFSHLQQRSTKDIASYC
VQLLPALCTHLENCHNHFQTVLSENNGVVDGPSTDVEEYQLMTSGYQLLLQVINTTFSWS
GFSQPGQRSLLKKALGVLAGRLKEGGPELTLDQLVRHSFEYLLNFRSTMPSLSTALCLSQ
LLSTLSEKGGNPGAFREQIASLARRFLSQGWVTASGERERGSKFNETLHTLLSIYLEHVD
DVLKAVEEIAGEGITELINAAKDESSASWPTLSRQTFLVFYKVLMAELEKAVRRIPPGKM
SDNSEAQSEKLLTWNLAVRDFHILVNLVKVFDSRPVLNVSLKYGRLFLESFLKLGMPLLD
YSFKRHKEDVQSLLKTFQLSTRQLHHMCGHSKIHQDTSLTNHVPAVKKSLELFVYRVKAM
LMLNNCQEAFWMGNLKNRNLKGEEILSQRSQGSDEDDEEEDQELPPEKSDDEGQESDSEE
IPRISRQGDSGEDSD
NT seq 4368 nt NT seq  +upstreamnt  +downstreamnt
atgtttggactatatttaatattccctaattatctaattccgatgatgcgcaaaaaacga
cgctcctcggtggaaaaggaagcgggaacaaccagcacctctaaggcaaagaagagtcgc
aggactggccaccagcccaaagaagtttcctcagaggagacaaacgaaactgtttttgtc
acttttgtgaaagaagccggagtcaacttgaaactcgatggcacagctcatgagatcgtt
gttgaccaggtagttttccagaagcgaataaggcaacagctgcagaaaagcccccgatac
cctggtatcctgaaggagtttataacagcactggaggcttacattgaaaacccagaaagg
tttaagaattgcctttttccctgtgttccacaacaatccgaggacgacatttgttctgtc
agctcattccaggaaagcctgctcagaatgttattgggcatcgaaatgctgcagactttg
ataataaacaccttgcttgaaaaaatccctgaatttatgcttgatggcgctgtggatgga
ggatttgattttcctcgtatgatcatcaaccagctgaagtggcttgacagagtcgtagat
ccaaaggaccttgcagtgaagctgatggagcttgtgtcagtagccccttttgaggtgcag
cgtgacatcatcaccagtttaccagagatacttgaagactctcagcatgatgacattgcc
agggagctcaatgctttacttcaggagaacactcagctaacggtccccatcctggatgcc
ctctccagtctcaacctctcatcatcattactgacagaggtccgcgatgcagttatggcc
acactgggctctgtgcaactacaggatctacctgtggtggtcaaattcatcctgcattct
gtctccgcctcagatgcatccgaggtggtgaataatctgcgcaaaaagctggtactagag
cagtgcgtccttcctccagttctgcaggcatcacagagccgcatgaagagcaaatcaaca
gcaggttctgcttccacaactgcatccggcagcagtcaagactgcgtcacgttgatactg
gactgcatcaagtcagcagttcggttccagaaaactatttctgaggcatggctcaaggca
atagagtctgtggatgaagtcgaagaccacaaggttttagatctgctgctgctcttcatc
ctccactgcaccaacgccaaccagagccgccggggggcagagagactgctaaagcttaaa
gtgagaaaagggctcattcaggaggctctgctacagaaaaccttcagggactactctcag
gtcctgcgagggtacttcccctctatcctggctctggctcagagtttggtgcgctcccct
gatccctgtgtggtgccttttggtgggcagatgcacagaatctctttcactgtgtttgac
gcttactgccagcaggcggttgttggctctcttgtgactcatgtgtgcagcggtgtaggt
ggggaggtagacgtggcgctggaactgctctgcaatcttgtaatggaaaaacccacagag
atggctctctatgctgtttttgtgaagggaatcctggactacatggacaatctcactccg
cagcagatcagaagactcttccatctcctgagcagagtggcgtttgggcagcagcaacaa
ggatctcacatccaggacgacatgcacatagtgatccgtaagcagctgtccagcacggtc
cccaaatacaagcgtataggaatcattggtgccgtgatgattgttggcagcatgggagcc
ttgaggtctaaagggaaggaatcacagggtggctctttgcctcaggagacactaagacag
gtgacggctctgttggagctggtgaagtcaagcagtgaaagctctccagaggcagcggct
ctgtactacgatgaactggccagccttatctggagttcttcgttggacccacaggtgcag
gaaatgattggaacaagcgtcctggatgacttccaagatgattttgtggtggacgtcgga
cctgaaatagcagggtcattcccccttccagcctttgccatgtacaacctagacgaggag
gagagccagggatgtatcgccatcaacctgctgcctctactggccaatgaaacccaaaac
aaagtcgattctcagagtggaaaacaacagaagcgggtgtcccctctctgtttatccccc
tttttccgcctcctgaggctctgtgaagagaaaagacatcagggagacctggaagagatt
gatgccctccttggctgtccgctgattctgaccaacatggatgtagtggataaagttgaa
agcctgtcgaaagctgagagggagttcctctgtactttactgtttcacaccatcaactgg
ttcagagaggtggtaaacgccttctgcaagcagaaagaaacagagatgaagatgaaggtg
atgactcgcttgcagaacataacttttctgcagactctgttggagagggctcttgcagga
atgtctgggtacattccccctgtttgtaactttgatggagaaactacagatgggatgaca
tccagttttggagtccctgtaaataagacaaagaaagatggaaccgggaaaaagagaaag
gctccaggtaagaacgttccagaaggagtctctcagcctgaggagggtactgaagcagat
gaaactcagcagcaggatcagccagagaaggagaaggaaaaagagatccggcctggtgtc
agtttggcagcatacaggcccttcttcagagagctggacatggaggtgctcagtgttctg
cagtgtggtttgttgtcacgctcactgctagacactgagctccacaccaaggttcgagag
gaggtcctgctgggcccgactgaactggccttcctgctagaggatatgctgcacaaagtg
gagttcagtcttacagctgccccagccaagagagctcctttcctcaaggcgagggctgat
aaaaccgtgggattctcacatctacaacagaggagtactaaagatattgcctcctactgt
gtccagctactgcctgccctctgcacacacctggaaaactgtcataatcattttcagacg
gtgctgtcggagaacaatggggttgtggatgggccttcaacagatgtggaggagtaccag
ctgatgacctcagggtaccagctcctcctgcaggtcatcaataccaccttcagttggtct
ggattcagccagccgggacagcggagcttgttgaagaaagctttgggagttttggcagga
cgactgaaagaagggggtcctgaactgacccttgatcagcttgtaaggcacagttttgag
tacctgctgaacttccgcagtacgatgccgagcctgagcacagctctgtgtctctctcag
cttctgtcaacgctgtcagagaagggaggaaaccctggtgccttcagagagcagattgct
tccctggcacgtcgtttcctgagccaaggttgggtgacagccagtggagagagagagcga
ggcagtaaattcaatgaaacacttcacacactcctaagcatctacctggagcacgttgac
gatgttctaaaggcagtggaggaaatagctggagaaggaatcactgagctcatcaatgca
gccaaagatgagagctctgcatcctggcccactctgagcaggcagacattcctggttttc
tataaggttttgatggctgagctggagaaagctgtcaggaggattcctccgggtaaaatg
agcgacaactctgaggctcaaagtgagaaactgctgacatggaacctggctgtcagagat
tttcacatcctggtcaacctcgtgaaggtgtttgattccaggccagtacttaatgtgtct
ctaaagtatggccgcctttttctggagtcttttctgaagttgggaatgccgctgctagac
tacagtttcaagaggcacaaggaggatgtccaaagcttgcttaagactttccagctcagc
acgaggcagctccaccacatgtgtggccattctaagattcaccaggacaccagcttgact
aaccacgtaccagctgtaaagaagagcctggagctgtttgtttacagagtgaaggccatg
ctgatgctcaacaactgccaggaggccttttggatgggaaacctgaagaatcgaaaccta
aagggtgaagagatcctttctcagagatcacagggaagtgatgaggacgatgaggaagag
gatcaggaattaccaccggaaaagtcagatgatgagggacaggaaagtgattctgaagaa
atcccccggatcagcagacagggtgacagtggagaggactctgattag

DBGET integrated database retrieval system