KEGG   Cyprinodon variegatus (sheepshead minnow): 107098194Help
Entry
107098194         CDS       T06110                                 

Gene name
fancb
Definition
(RefSeq) Fanconi anemia group B protein
  KO
K10889  fanconi anemia group B protein
Organism
cvg  Cyprinodon variegatus (sheepshead minnow)
Pathway
cvg03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cvg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    107098194 (fancb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cvg03400]
    107098194 (fancb)
DNA repair and recombination proteins [BR:cvg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex
     107098194 (fancb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 107098194
NCBI-ProteinID: XP_015251197
LinkDB All DBs
Position
Unknown
AA seq 845 aa AA seqDB search
MEPFSPEDLYQNPHRLSHSGKIILFTCNQDPACNGSERNWLNFRSFSFAREVNAFLKATE
GTAAISRKLSAHVDIVTCNCAVDVQRRVKTPFVLVTKKSEKGGSFQYSLLSLNGLDRLEP
CIEFKLPYQMQGNVRILQGPTVLWSHDQSVFYTSPNAKGVRMIPIQMSKCVFGEIHIHKG
QIFALGLSEAPLTNQYPTLGYFLEKGQVFEGSSILPHPYICITQCMQVLTADRVDDVLRC
VVIAATSHQQLVLFENGLVKETCELPFEQAEDIQIVNTGRNGCLFVVFFKQGHVCSVWKD
TFQIASCWSDVGSVHVDDFFRCGTEQMLLLFKNQSLAKEPLENFLLTDLCGISYSCGQGF
EGMKTSLPPQESSLLTLRALESRLQSGLIVLQELESELRVKDRVLQQSIQVLTATLSGRE
TFLSQPEQEGLVALWDSDEEESNDKTLDDRMHETPAPTSKPKIDKLWHRIADDQLVVGLI
LNAESDILASGVSLSLLTEPGQSLMPAVIQTRSQVFWLPALSPSTPTLSSSSSSNIFLEP
AAKRSKQHLASNDLNVCRLAVTAATKLTPLLTSGSVKCHAMLHYKKGEALFPRSNPTTAV
LHCGDISVDIHDLCLKPLLQNPQVKTDEVREDLLSLLTVLDHWVLHIDSPDYSLGDIDGW
IRRRENFKKIEVSPEYLLLDSPGPSVPMLLRWYQMNPFQGDLSIHSSQLQMLQFLDSMLT
FLPESCFIRPVNFTRSQSTAQEFASALEKEVLSLREGLSSLLCGKAEEERNEAHTGHGGI
PETGSAQELVGCTREVWQQNVERSRLSLSPLVDVKRYREMIQRLLKVKMDADLAGVQQAH
MNLVS
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atggagccgttttccccggaagatttgtatcaaaatcctcacagactctcacacagcgga
aagataatcctatttacctgcaaccaagacccagcctgcaatggaagcgaaagaaactgg
ctaaacttccgcagcttctcctttgcacgtgaagtcaacgcgttcctgaaggcaacagag
gggacagcagccatcagcaggaaactgtcagctcatgtggacatcgtgacgtgtaactgt
gctgtagatgttcagagaagggttaaaactccgttcgttttggtgacaaagaagagtgaa
aaagggggcagcttccagtatagtctgctctcacttaacggtttagacagactggagccc
tgcatcgagttcaagcttccctatcaaatgcagggaaacgtgcgcatcctgcagggcccc
acagtgctgtggagccacgatcaaagcgtgttttatacatcccccaatgcaaagggggtc
agaatgatccccattcaaatgtcaaaatgtgtttttggagagatccacatccacaaagga
cagatttttgctcttggactttcagaagcacccctaactaaccaataccctacacttggt
tattttcttgaaaagggacaagtgtttgagggctcttcgattttgccccatccctacatt
tgtatcacacagtgcatgcaggttctaacagctgatagggtggatgatgtgctgagatgt
gttgttattgcagcaacttcacatcagcagcttgtgctttttgaaaatggtttagttaaa
gaaacgtgtgaactgccctttgagcaggctgaagacattcagattgttaacacagggaga
aatggctgtctttttgttgtattctttaagcagggccatgtttgttctgtgtggaaggac
acattccagatagcctcctgttggtcagatgtcggctccgtccatgtggatgatttcttc
aggtgcggaactgagcagatgcttctgcttttcaagaaccaaagcttagcaaaggagcca
ctggaaaatttccttctgactgacctttgtggtatttcttactcttgtggtcaaggcttt
gaaggcatgaagacaagcttgcctcctcaggaaagctcactcctcactcttcgagctttg
gaatccagattacagagtggattgattgtcctccaagagcttgaaagtgaactgagagtg
aaggacagagttctgcagcaatcaatccaagtcctcactgcaacactttcagggagggag
acctttctaagccaacctgagcaggaagggcttgttgccctttgggacagtgatgaggag
gagtccaacgataagaccctggatgacaggatgcatgaaacaccagcgccgacctccaaa
cccaaaattgacaagctctggcaccgcatcgctgatgaccaactggttgttggattgatt
ctaaatgctgaaagtgacattctggcaagcggtgtgagcttatccctcctgacagagcca
ggccagagcctgatgcctgcggtaatccagacccgtagccaagtgttctggctgcctgcg
ctcagcccctcaacaccaactctctcctcctcatcgtctagcaacatattcttagagcct
gcagccaaaaggagcaagcagcacctcgccagcaatgatctgaatgtgtgtagactggct
gtgactgcagcaaccaagctgacacctctgctgacctctggcagtgtcaagtgccatgcc
atgcttcattacaagaaaggagaggctcttttccccaggagcaacccgacaacagctgta
ctgcattgtggcgacatttctgtagatatccatgatctttgcctgaagcctctgctacaa
aaccctcaagtcaaaacagatgaggttagagaagaccttttgagtcttttgacagtgctg
gatcactgggtcttgcatatagactctccagattatagtttgggtgacatagatggctgg
attcggaggagagagaactttaaaaagatagaagtaagccctgagtatctacttttagat
tctccagggccttctgttccaatgctgctccgctggtaccagatgaaccctttccaaggg
gatttgtccatccactccagccaattacaaatgctccagttcttagactccatgctgaca
ttcctccctgaatcctgcttcatccgacctgtcaacttcacaaggagtcaaagtacagct
caagaatttgcctccgctctagaaaaagaggtgctgtcactcagagagggcttatcatca
cttctgtgtgggaaagctgaagaggagagaaatgaggcacacactggacatgggggaatc
cctgagactggttctgcacaggagcttgttgggtgtacacgggaggtgtggcagcagaac
gtggagaggagcaggttgagtctgagccctctggtggatgtcaagaggtatcgtgagatg
atccaaagacttttaaaagtcaagatggatgcagatttagccggcgttcaacaggcacac
atgaatttggtcagttga

DBGET integrated database retrieval system