KEGG   Crocosphaera watsonii: CwatDRAFT_3423
Entry
CwatDRAFT_3423    CDS       T05097                                 

Definition
(GenBank) Biotin/lipoyl attachment:Catalytic domain of components of various dehydrogenase complexes:E3 binding
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cwa  Crocosphaera watsonii
Pathway
cwa00010  Glycolysis / Gluconeogenesis
cwa00020  Citrate cycle (TCA cycle)
cwa00620  Pyruvate metabolism
cwa01100  Metabolic pathways
cwa01110  Biosynthesis of secondary metabolites
cwa01120  Microbial metabolism in diverse environments
cwa01200  Carbon metabolism
Module
cwa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cwa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CwatDRAFT_3423
   00020 Citrate cycle (TCA cycle)
    CwatDRAFT_3423
   00620 Pyruvate metabolism
    CwatDRAFT_3423
Enzymes [BR:cwa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CwatDRAFT_3423
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PASTA
Other DBs
NCBI-ProteinID: EAM50398
UniProt: Q4C2L7
LinkDB
Position
complement(688..1977)
AA seq 429 aa
MIHDIFMPALSSTMTEGKIVSWTKSPGDKVSKGETVVVVESDKADMDVESFYDGYLATIL
VEAGQEAPVGDAIALIAETEAEIAQAQQKSPSSPQKSPEPSPPQKEELATATAPVSTATA
TVTAPPSTNGKSNRIVASPRAKKLAKQLGIALNTVEGSGPYGRIVAEDIEKAAGKTPTPP
AIATQTPVTTPTPKVAVTPTPTPVTAGETVPLNTLQKAVVQNMMATLQVPTFHVGYTITT
DELDKLYKQLKPKGVTMTALLAKAVAVTLEKHPVVNANYGEQSIRYPQSINIAIAVAMPD
GGLITPVLQNADKIDIYSLSRTWKDLVDRARSKQLQPEEYSSGTFTLSNLGMFGVDRFDA
ILPPGQGSILAIGASSPQVVATADALLGVKRQMAVNITCDHRVIYGSDAAAFLQEFANLL
ENNVQSLTM
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgattcacgatattttcatgcctgcattaagttctaccatgaccgagggaaaaattgtc
tcttggactaagtctccaggggataaagtctccaaaggagaaaccgtggtggttgtagaa
tcagataaagcagatatggatgtagaatctttctatgacggctatttagctactatttta
gtcgaagcaggccaagaagctccagtgggagatgcgatcgctttaatcgcagaaacagag
gcagaaattgcccaagctcaacaaaaatcaccttctagtcctcagaaatctcctgaaccg
tccccacctcaaaaagaggaattagccactgctacagccccagtaagcactgctacagca
acagttacggctcctccatcaaccaacgggaaaagtaacagaattgttgcctcccctcgg
gctaaaaagttagctaaacagttagggatcgcccttaataccgttgaaggtagtggacct
tacggcagaattgtagcagaagatattgaaaaggccgcaggaaaaacccccactccccct
gctattgctactcaaacccctgtaactactcctacccccaaagtagcagttacacctact
cctaccccggtaaccgcaggagaaactgttcccctgaatacgttacaaaaggcagtggta
caaaatatgatggctaccctacaggttcccaccttccatgtgggttacaccatcaccacc
gatgagttggataaactctataagcaactgaaaccgaaaggggtgacaatgacggcgtta
ttggccaaagcggtggcagttaccctggaaaaacatcctgtggtaaatgctaactatggt
gagcaaagtattcgttatcctcagtctattaatattgcgatcgctgttgctatgccggat
ggtggtttaattactcctgtcttacaaaacgccgataagattgacatttattccctgtct
cgtacctggaaagatttagtagacagagcgcggtctaaacagttacaaccagaagaatat
agtagcggtacctttaccctctctaacttgggaatgtttggggtagatcgttttgatgct
attttaccccccggccaaggatcaattttagcgatcggtgcatccagtccccaagtggta
gcaactgctgatgctttattgggagttaagcgtcaaatggcggttaatattacctgcgat
catcgggttatttatggttcagatgctgctgctttcttacaagagtttgccaacttgtta
gaaaataatgttcaatctttaaccatgtaa

DBGET integrated database retrieval system