KEGG   Crocosphaera watsonii: CwatDRAFT_3423Help
Entry
CwatDRAFT_3423    CDS       T05097                                 

Definition
(GenBank) Biotin/lipoyl attachment:Catalytic domain of components of various dehydrogenase complexes:E3 binding
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cwa  Crocosphaera watsonii
Pathway
cwa00010  Glycolysis / Gluconeogenesis
cwa00020  Citrate cycle (TCA cycle)
cwa00620  Pyruvate metabolism
cwa01100  Metabolic pathways
cwa01110  Biosynthesis of secondary metabolites
cwa01120  Microbial metabolism in diverse environments
cwa01130  Biosynthesis of antibiotics
cwa01200  Carbon metabolism
Module
cwa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cwa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CwatDRAFT_3423
   00020 Citrate cycle (TCA cycle)
    CwatDRAFT_3423
   00620 Pyruvate metabolism
    CwatDRAFT_3423
Enzymes [BR:cwa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CwatDRAFT_3423
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PASTA Imm1
Motif
Other DBs
NCBI-ProteinID: EAM50398
UniProt: Q4C2L7
LinkDB All DBs
Position
complement(688..1977)
AA seq 429 aa AA seqDB search
MIHDIFMPALSSTMTEGKIVSWTKSPGDKVSKGETVVVVESDKADMDVESFYDGYLATIL
VEAGQEAPVGDAIALIAETEAEIAQAQQKSPSSPQKSPEPSPPQKEELATATAPVSTATA
TVTAPPSTNGKSNRIVASPRAKKLAKQLGIALNTVEGSGPYGRIVAEDIEKAAGKTPTPP
AIATQTPVTTPTPKVAVTPTPTPVTAGETVPLNTLQKAVVQNMMATLQVPTFHVGYTITT
DELDKLYKQLKPKGVTMTALLAKAVAVTLEKHPVVNANYGEQSIRYPQSINIAIAVAMPD
GGLITPVLQNADKIDIYSLSRTWKDLVDRARSKQLQPEEYSSGTFTLSNLGMFGVDRFDA
ILPPGQGSILAIGASSPQVVATADALLGVKRQMAVNITCDHRVIYGSDAAAFLQEFANLL
ENNVQSLTM
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgatattttcatgcctgcattaagttctaccatgaccgagggaaaaattgtc
tcttggactaagtctccaggggataaagtctccaaaggagaaaccgtggtggttgtagaa
tcagataaagcagatatggatgtagaatctttctatgacggctatttagctactatttta
gtcgaagcaggccaagaagctccagtgggagatgcgatcgctttaatcgcagaaacagag
gcagaaattgcccaagctcaacaaaaatcaccttctagtcctcagaaatctcctgaaccg
tccccacctcaaaaagaggaattagccactgctacagccccagtaagcactgctacagca
acagttacggctcctccatcaaccaacgggaaaagtaacagaattgttgcctcccctcgg
gctaaaaagttagctaaacagttagggatcgcccttaataccgttgaaggtagtggacct
tacggcagaattgtagcagaagatattgaaaaggccgcaggaaaaacccccactccccct
gctattgctactcaaacccctgtaactactcctacccccaaagtagcagttacacctact
cctaccccggtaaccgcaggagaaactgttcccctgaatacgttacaaaaggcagtggta
caaaatatgatggctaccctacaggttcccaccttccatgtgggttacaccatcaccacc
gatgagttggataaactctataagcaactgaaaccgaaaggggtgacaatgacggcgtta
ttggccaaagcggtggcagttaccctggaaaaacatcctgtggtaaatgctaactatggt
gagcaaagtattcgttatcctcagtctattaatattgcgatcgctgttgctatgccggat
ggtggtttaattactcctgtcttacaaaacgccgataagattgacatttattccctgtct
cgtacctggaaagatttagtagacagagcgcggtctaaacagttacaaccagaagaatat
agtagcggtacctttaccctctctaacttgggaatgtttggggtagatcgttttgatgct
attttaccccccggccaaggatcaattttagcgatcggtgcatccagtccccaagtggta
gcaactgctgatgctttattgggagttaagcgtcaaatggcggttaatattacctgcgat
catcgggttatttatggttcagatgctgctgctttcttacaagagtttgccaacttgtta
gaaaataatgttcaatctttaaccatgtaa

DBGET integrated database retrieval system