KEGG   Synechococcus sp. JA-3-3Ab: CYA_0742
Entry
CYA_0742          CDS       T00318                                 

Definition
(GenBank) putative 2-oxo acid dehydrogenase, acyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cya  Synechococcus sp. JA-3-3Ab
Pathway
cya00010  Glycolysis / Gluconeogenesis
cya00020  Citrate cycle (TCA cycle)
cya00620  Pyruvate metabolism
cya01100  Metabolic pathways
cya01110  Biosynthesis of secondary metabolites
cya01120  Microbial metabolism in diverse environments
cya01200  Carbon metabolism
Module
cya_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CYA_0742
   00020 Citrate cycle (TCA cycle)
    CYA_0742
   00620 Pyruvate metabolism
    CYA_0742
Enzymes [BR:cya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CYA_0742
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MadL
Other DBs
NCBI-ProteinID: ABC98952
CyanoBase: CYA_0742
CYORF: CYA_0742
UniProt: Q2JWB6
LinkDB
Position
749181..750440
AA seq 419 aa
MIHELSMPALSSTMETGKIVAWLKNPGDRVEKGENILVVESDKADMDVESFHSGILASIL
IPAGESAPVGAPIALIAETEAEVAEAQERAKALSKGALPATAPTAVPTPTVQQPTPVPAA
IPTPTLPTGSNGAGSQRILASPRAKKLAESLGIDLRTVRGSGPGGRIVAEDVERAAAQAA
STQAAAPPPVSAAAPLGEVVPLSTLQAAVVRNMNASLGVPVFHVGYTITTDSLDQLYQQV
KPKGVTLTALLVKAVALTLEKHPLLNASYTENGIHYKAEINIAVAVAMEDGGLITPVLKQ
ANRVDLYELSRRWKELVERARRKQLQPEEYNSGTFTLSNLGMFGVDRFDAILPPNQGAIL
AVGAARPTVVATPEKAIAIRSQMQVNLTCDHRVIYGAHAAAFLQDLAQLLEQKVGSLTL
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgatccacgaactctccatgccggccctcagctccaccatggaaacgggcaagatcgtc
gcctggctgaaaaaccccggcgaccgggtggagaaaggggaaaacatcctggtggtggag
tcggacaaggcggacatggacgtggagtccttccacagcggcattctggccagcatcctc
atcccagcaggggaatcggcgccggtgggcgcccccatcgccctcattgccgaaaccgaa
gcggaggtggccgaggcccaagagcgagccaaggccctctctaagggtgctctaccggca
actgcacctactgcagtccccacccccacagttcaacagccaacccctgtccctgcggcg
atccccacccccacccttccaactggctccaacggggccggatcccagcggatcctggct
tccccacgggcgaaaaaattggcagaaagcctggggatcgacctgcgcacggtgcgcggc
tccggccctggtgggcgcatcgtggccgaagatgtggagcgggctgcagctcaggccgcc
tctacgcaagcggcagctcccccccctgtctctgcggctgccccgttgggagaagtggtt
cccttgagcacgttgcaggcggcggtggtgcgcaacatgaacgccagcttgggcgtgccg
gtgttccacgtcggctacaccatcaccaccgacagcctggatcagctttaccaacaggtg
aagcccaaaggggtaaccctgacggcccttttggtgaaagcggtggccctgaccctagaa
aagcatcccctcctcaacgccagctacacggaaaacgggatccactacaaagccgagatc
aacattgccgtggcggtggccatggaagacggcggcctgatcacccctgtgctcaagcag
gccaaccgcgttgacctgtacgaactctcacggcgttggaaggagctggtggagcgggcg
cggcgcaagcaactgcagccggaggagtacaacagcggcacctttaccctctccaacctg
ggcatgtttggggtggatcgcttcgacgccatcctgcctcccaaccaaggagctattttg
gccgtcggcgctgctcgccccaccgtggtggccacaccagaaaaagccatcgccatccgc
tcccagatgcaggtcaacctcacctgcgaccaccgcgtcatttacggcgcccacgctgcg
gccttcttgcaagatctggcccagttgttagaacaaaaggtgggatccctgacgctgtag

DBGET integrated database retrieval system