KEGG   Synechococcus sp. JA-2-3B'a(2-13): CYB_0942Help
Entry
CYB_0942          CDS       T00319                                 

Gene name
cpcE-1
Definition
(GenBank) phycocyanin alpha subunit phycocyanobilin lyase, CpcE subunit
  KO
K02288  phycocyanobilin lyase subunit alpha [EC:4.4.1.32]
Organism
cyb  Synechococcus sp. JA-2-3B'a(2-13)
Pathway
cyb00196  Photosynthesis - antenna proteins
cyb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyb00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    CYB_0942 (cpcE-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:cyb00194]
    CYB_0942 (cpcE-1)
Enzymes [BR:cyb01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.32  C-phycocyanin alpha-cysteine-84 phycocyanobilin lyase
     CYB_0942 (cpcE-1)
Photosynthesis proteins [BR:cyb00194]
 Antenna proteins
  Phycobilisome - Cyanobacteria, Red alga [OT]
   Phycocyanin (PC)
    CYB_0942 (cpcE-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEAT_2 HEAT_PBS Arm HEAT HEAT_EZ La_HTH_kDCL
Motif
Other DBs
NCBI-ProteinID: ABD01921
CyanoBase: CYB_0942
CYORF: CYB_0942
UniProt: Q2JMW1
LinkDB All DBs
Position
978721..979473
Genome map
AA seq 250 aa AA seqDB search
MLPQQLTWEQAIARLQGDDLQDRYYAAWYLGTVRDPRGVEPLLLALQDERDRTALGGYPL
RRNAAKALGQIGDARAVPGLIEALTCTDFHVREEAAYALAQLGDKRAVDPLLALLQSREQ
EQPWEALIEALGQLQATEAEAAIRPFLNHPSERVRSAAAWVLYRFTQAEELTQILVALLA
HSNSSLRQAALFDLAESGWVAGAPLLATADVALNLRINALKRLFDVALQLGWVPLAQVTA
VILPQLEKLF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgctgccgcagcagctcacttgggagcaggcgatagcccggctgcagggggatgacttg
caagatcggtactatgctgcctggtacctgggcacagttcgggatccaaggggggtagag
ccgctgcttttggcgttgcaggatgagcgggatcgcactgccttggggggctatcctctg
cgccgcaatgccgctaaggccctggggcaaatcggggatgcgcgggccgtgcccggtttg
atcgaggcgctcacttgtaccgactttcatgtgcgggaagaggctgcctatgccttggct
caattgggggacaagcgagcggtggatcccttgctggcactgttgcagtcccgcgagcag
gagcagccctgggaagcccttatcgaggccttgggtcagcttcaggccaccgaggctgag
gcagcgatccggccctttttgaaccatccctctgagcgggtgcgttcggcagcggcttgg
gtgctctatcgctttacgcaagccgaggagctgacccaaatcctggtggcgctactggcc
cactccaactccagcctacgacaggccgctttgttcgacctggccgaatcgggatgggta
gcgggggcgccgctgctggccacagccgacgtggctctcaacctgcgcatcaatgctctg
aagcggctgttcgatgtggcgcttcagttggggtgggtgccgctggctcaggtgacggcg
gtgatcctgccgcaactggagaagctcttctag

DBGET integrated database retrieval system