KEGG   Rippkaea orientalis PCC 8802: Cyan8802_3968
Entry
Cyan8802_3968     CDS       T00968                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
cyh  Rippkaea orientalis PCC 8802
Pathway
cyh00010  Glycolysis / Gluconeogenesis
cyh00020  Citrate cycle (TCA cycle)
cyh00260  Glycine, serine and threonine metabolism
cyh00280  Valine, leucine and isoleucine degradation
cyh00310  Lysine degradation
cyh00380  Tryptophan metabolism
cyh00620  Pyruvate metabolism
cyh00630  Glyoxylate and dicarboxylate metabolism
cyh00640  Propanoate metabolism
cyh01100  Metabolic pathways
cyh01110  Biosynthesis of secondary metabolites
cyh01120  Microbial metabolism in diverse environments
cyh01200  Carbon metabolism
cyh01240  Biosynthesis of cofactors
Module
cyh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan8802_3968
   00020 Citrate cycle (TCA cycle)
    Cyan8802_3968
   00620 Pyruvate metabolism
    Cyan8802_3968
   00630 Glyoxylate and dicarboxylate metabolism
    Cyan8802_3968
   00640 Propanoate metabolism
    Cyan8802_3968
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyan8802_3968
   00280 Valine, leucine and isoleucine degradation
    Cyan8802_3968
   00310 Lysine degradation
    Cyan8802_3968
   00380 Tryptophan metabolism
    Cyan8802_3968
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cyh04147]
    Cyan8802_3968
Enzymes [BR:cyh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Cyan8802_3968
Exosome [BR:cyh04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Cyan8802_3968
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox GIDA FAD_binding_2 FAD_oxidored DAO K_oxygenase AlaDh_PNT_C UDPG_MGDP_dh_N Pyr_redox_3 Thi4 2-Hacid_dh_C MukF_M HI0933_like
Other DBs
NCBI-ProteinID: ACV02771
LinkDB
Position
4084461..4085891
AA seq 476 aa
MSEQFDYDLVIIGAGVGGHGAAIHAVQCGLKTAIIEAKDMGGTCVNRGCIPSKALLAASG
RVRELRDTHHLNSLGIQVGGVNFQREAIADHATNLVNKIRGELTNSLKRLKVDTIHGWGK
ILDSQKVSVLTDNGEKIITAKDIMLCPGSVPFVPRGVEIDHKTVFTSDEAVKLETLPQWI
AIIGSGYIGLEFSDIYTALGCEVTMIEALDTLMPGFDPEISKLAERILLKTRDIETYSGV
FATKITPGSPVTIELTDAKTKEVLDVLEVDACLVATGRIPATKNLGLENLGIETQRGFIP
VNDRLEVLKDGEPVPHLWAVGDATGKMMLAHAASGQGVIAVENICGRDKTIDYRSIPAAA
FTHPEISYVGLTEPQARELGEQEGFTVASVKTYFKGNSKALAEGETDGIAKVVFRQDTGE
LLGVHIIGIHASDLIQEAANAIAQRQSVTHLAFNVHTHPTLSEVLDEAFKRAEVAV
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgagtgaacagtttgattatgatttagtcattatcggggcaggagttggcggccatggt
gcagctatccatgcagtacaatgtggactgaaaaccgccattatcgaagccaaagacatg
ggaggaacctgtgttaaccgaggctgtatcccttctaaagccctcctcgcagcctcagga
cgggttagagaactacgggacacccatcacctcaacagtctgggtattcaagtcggtggg
gtcaattttcaacgggaagcgatcgccgatcatgctaccaatttagtcaataaaattcgt
ggtgagctcaccaacagccttaaacgtctcaaagttgataccatccacggttggggaaaa
attctcgatagccaaaaagtgagtgtattgaccgataatggcgaaaaaatcatcaccgct
aaggatatcatgctctgtccagggtcggttccctttgtcccccgtggtgtcgaaattgac
cataaaaccgtctttaccagtgatgaggcagtaaaattagaaaccctaccccaatggatc
gctattattggaagtggctacatcggactcgaattttcggacatttacaccgctttaggc
tgtgaagtaacgatgatcgaagcgttagacaccctcatgccagggtttgatcccgaaatt
tccaaactagcggaacgaattttactgaaaacccgcgatattgaaacctattcgggcgtt
tttgctacaaaaatcaccccaggttctcccgttaccattgaattaaccgatgcgaagaca
aaagaggttcttgatgtcctagaggtggatgcctgtttagtcgctaccggacgcatacca
gcgaccaagaacctagggttagaaaacctaggaattgagacacaacggggctttattccc
gttaatgaccgtttagaagtcctcaaagatggcgaacccgtgccccatctttgggcggtg
ggcgatgctacaggtaaaatgatgttagcccatgcagcatcgggtcagggagtgattgcc
gtagaaaatatctgtgggcgcgataaaaccatcgattatcgcagtattccggctgcagcc
tttacccatcccgaaattagttacgttgggttaacggaaccccaagcaagggaattaggc
gaacaagaagggtttaccgtagcgtcggttaaaacctattttaagggcaattctaaggct
ttagccgaaggagaaaccgatggtatcgctaaggtggtttttcgccaggatacgggcgaa
ttattaggcgttcatattattggcatccatgcgtccgatttaattcaagaggccgctaat
gcgatcgcccaacgtcagtctgttacccatttagcctttaacgtacatactcatcctacc
ttatcagaagtcctcgatgaagcttttaaacgcgctgaagtagccgtttaa

DBGET integrated database retrieval system