KEGG   Cyanothece sp. PCC 7822: Cyan7822_4864Help
Entry
Cyan7822_4864     CDS       T01310                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyj  Cyanothece sp. PCC 7822
Pathway
cyj00010  Glycolysis / Gluconeogenesis
cyj00020  Citrate cycle (TCA cycle)
cyj00620  Pyruvate metabolism
cyj01100  Metabolic pathways
cyj01110  Biosynthesis of secondary metabolites
cyj01120  Microbial metabolism in diverse environments
cyj01130  Biosynthesis of antibiotics
cyj01200  Carbon metabolism
Module
cyj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7822_4864
   00020 Citrate cycle (TCA cycle)
    Cyan7822_4864
   00620 Pyruvate metabolism
    Cyan7822_4864
Enzymes [BR:cyj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cyan7822_4864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MadL Aminotran_1_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ADN16755
UniProt: E0UGD6
LinkDB All DBs
Position
5284077..5285390
Genome map
AA seq 437 aa AA seqDB search
MIHDIFMPALSSTMTEGKIVSWVKSPGDKVAKGETVVVVESDKADMDVESFFDGYLAAII
VNAGEEAPVGAAIALVAETQEEIKEAQAKAAAAQGNSGATVSETPSAPEPAPEPVLAAAG
GVSSAPSQSNGRLVASPRAKKLAKELGIDIKSLQGSGPFGRITGEDVERAAGKVSPPEPA
PISKPAPSQVPVAIPTPSAQPVVPAVAAPAGAASGEVVGFNTLQKAVVQNMVASMQAPQF
RVGYTITTDALDELYKKVKSKGVTMTALLAKAVAVTLQKHPVVNASYTDKGIQYHSSINI
AVAVAMPGGGLITPVLQQADQTDLYSLSRQWKDLVERARLKQLQPEEYSSGTFTISNLGM
FGVDRFDAILPVGQGSILAIGASRPQVVATAEGLLGVKRQMCVNITCDHRVIYGADAAAF
LQDLAKLIETNPQSLTL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgatatatttatgccggctctcagttccaccatgaccgaagggaaaatcgtc
tcttgggtaaaatctcctggagacaaagtggctaaaggggaaacagtggtcgtagtggag
tcggacaaggccgacatggacgttgaatcattctttgatggctatttagcggcaatcatc
gttaatgctggagaagaagctcccgtcggtgcagccatcgctcttgttgctgaaacccaa
gaagaaatcaaagaggcccaagccaaagcggctgcggctcaaggaaattcgggagcgaca
gtcagcgaaaccccatccgccccagaaccggcccctgaacccgttttagccgccgccggt
ggagtctcttctgccccgagtcaaagcaatggtcgtcttgtggcctctccgagagcgaaa
aaactcgcgaaagagctaggtattgacatcaaaagtctacaaggcagtgggccttttggc
agaattaccggagaagatgtagaacgggctgccggtaaagtttctccaccggagccggct
ccgatttccaagccagcaccgagccaggttccggtggcgattcccaccccttctgctcaa
ccggtggtgcctgcggtggcggccccggctggtgctgcaagcggcgaagtagtgggcttt
aataccctacaaaaagccgtagtacagaacatggtagccagtatgcaggctcctcagttc
cgggtaggatacaccattactactgatgctctcgatgaactctataaaaaagttaagagc
aaaggggtaaccatgacagctttattagctaaagcggtagcggttactttacaaaaacat
cccgttgtcaatgcgagttataccgataaaggcatacaataccactcatcgattaatatt
gccgtcgcagtagcgatgccgggtggtgggttaattacccctgtactgcaacaagcggac
caaacagatttgtattctctgtctcgtcagtggaaagatttggtagagcgtgcccgactc
aaacaactgcaacccgaagaatatagtagcggcacttttacaatttctaatttgggaatg
tttggcgttgatcgttttgatgctatcctgccggttggacaagggtcgatcttagccatc
ggtgcttctcgtcctcaagtggttgccactgctgaagggcttttaggggttaagcgtcaa
atgtgcgttaatattacctgtgatcaccgggtgatttatggggctgatgcggcggctttc
ctacaagatttggctaagttgatcgaaactaatccccaatctttaaccctttaa

DBGET integrated database retrieval system