KEGG   Cyanobacterium sp. HL-69: AA637_06310Help
Entry
AA637_06310       CDS       T05309                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cyl  Cyanobacterium sp. HL-69
Pathway
cyl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cyl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AA637_06310 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cyl02000]
    AA637_06310 (gst)
Enzymes [BR:cyl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AA637_06310 (gst)
Transporters [BR:cyl02000]
 Other Transporters
  Pores ion channels [TC:1]
   AA637_06310 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_C_5 GST_N GST_N_4 Glutaredoxin GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AUC60784
UniProt: A0A2K8WNU8
LinkDB All DBs
Position
complement(1326205..1327425)
Genome map
AA seq 406 aa AA seqDB search
MAIAPLPWQELEQLTDYHIDRVNGPTNSQSTLRLFNHSEDEVRVTLYRDNHAWCPYCQKI
WLWLEEKQIPYRIKKVTMFCYGQKESWYKQKVPSGMLPALELDGKIITESDDILIALEQA
FGVLKFGMEEKNVLPMRKLERLLFRAWCTWLCYPTILPQQEANNRKQFIQVVKKVESAIA
QTPSPYFLEDFSTADVIFTPYVERMNASLYYYKGYSLREENPQLSAWFDAMETRPTYRGT
QSDFHTHAHDLPPQMGGCYSNGESQTLQNQEKVDRGDWFFLPDVAYPEPENSRQEALHRV
LKHRQNIIEVNPADNQLFDQALRCALTQMMTGEDCKPPAQSALGLRYLLDRINVPRDMSI
YAGKRLRQALEYTASLDSNIQPDPLPIRHRRDQNPLNFRGGVVSEK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgcacctttaccttggcaagaactagaacaattaacggattatcatatcgat
agagtaaacggccccaccaactcccaaagcaccctcagactcttcaaccactccgaagat
gaagtcagagtaaccctctatcgagataatcatgcttggtgtccctattgtcaaaaaata
tggctgtggttagaagaaaaacaaatcccctaccgcatcaaaaaagtaaccatgttttgt
tatggtcaaaaagaatcatggtataaacaaaaagtaccttcaggaatgctccctgccctc
gaattagatggtaaaattatcaccgaaagtgatgacatcttaatcgccctagaacaagcc
tttggggtactaaagttcggcatggaagagaaaaacgtactgcccatgcgcaaacttgaa
aggctactatttagggcatggtgtacatggctatgttatcccaccatcctcccccaacaa
gaagccaataatcgtaaacaatttatccaagtagttaagaaagttgaaagtgcgatcgcc
caaacccccagcccttactttctcgaagactttagcaccgccgatgtaatttttaccccc
tatgtagagagaatgaatgccagtctttattactacaaaggctattcattacgagaagaa
aatccccaactctctgcttggtttgatgccatggaaacccgccccacctaccgagggacc
caaagtgattttcatacccatgcccacgacttaccgccccaaatgggaggatgttatagt
aacggtgaatcccaaaccttacaaaatcaagaaaaagtagatcgaggagattggtttttc
ttacccgatgtagcttaccctgagccagaaaattcccgccaagaagccctccaccgagtc
ttaaaacatcgtcaaaatattattgaagttaatcccgcagataatcaattatttgaccaa
gccttgcgctgtgccttaacccaaatgatgacaggggaagattgtaaacctcctgcccaa
tctgcccttggattaagatatttactcgataggataaatgtacctcgagatatgtccatc
tatgcaggaaaaagactacgacaggcattagaatataccgctagtttggatagtaacata
caaccagaccccttacccatccgccatcgtcgtgatcaaaatcccctcaactttcgagga
ggagtcgtgagtgagaaataa

DBGET integrated database retrieval system