KEGG   Cycloclasticus sp. PY97N: CPC19_07900Help
Entry
CPC19_07900       CDS       T05126                                 

Definition
(GenBank) anthranilate 1,2-dioxygenase
  KO
K16320  anthranilate 1,2-dioxygenase small subunit [EC:1.14.12.1]
Organism
cyy  Cycloclasticus sp. PY97N
Pathway
cyy00627  Aminobenzoate degradation
cyy01100  Metabolic pathways
cyy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cyy00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CPC19_07900
Enzymes [BR:cyy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     CPC19_07900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SnoaL_4 Ring_hydroxyl_B NTF2
Motif
Other DBs
NCBI-ProteinID: ATI03397
LinkDB All DBs
Position
complement(1611274..1611759)
Genome map
AA seq 161 aa AA seqDB search
MPNIPLTIELKSEVEQLLNSYVQCIDDDDLEHWPDFFTEDCLYQIIPRENHEIGLPTAVI
WCDSRGMLADRVTALRHANVYQVQWYRHIISNPMISTEDGETFHVQSNYAVFKTCNDGES
SVYNVGRYVDEIVRDEGVLKFKKRSAIYDTHRITTLMVIPI
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatatacccttaaccatagaattaaaaagcgaagtagaacaactgcttaatagc
tatgtccagtgtattgatgatgatgaccttgaacattggccagactttttcacggaagat
tgtttgtaccaaatcattcctagggaaaaccatgaaataggcttgccaacagcggtgatc
tggtgcgatagccgtggaatgttagctgaccgtgttacagctttgcgtcatgcaaatgta
tatcaagtgcagtggtaccgtcacattattagcaacccaatgatcagtacagaagacgga
gagacctttcatgtgcagtctaattatgcggtctttaaaacatgtaacgacggtgaaagt
agcgtttacaacgtgggtcgttatgtcgatgaaatagttcgtgatgaaggggttcttaag
tttaaaaagcgttctgctatttatgacactcatcgaattacgactctgatggttatccca
atttaa

DBGET integrated database retrieval system