KEGG   Cycloclasticus zancles: CYCME_1631
Entry
CYCME_1631        CDS       T02780                                 

Definition
(GenBank) Alpha/beta fold family hydrolase
  KO
K15756  2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoate hydrolase [EC:3.7.1.13]
Organism
cza  Cycloclasticus zancles
Pathway
cza00621  Dioxin degradation
cza01100  Metabolic pathways
cza01120  Microbial metabolism in diverse environments
cza01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cza00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    CYCME_1631
Enzymes [BR:cza01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.13  2-hydroxy-6-oxo-6-(2-aminophenyl)hexa-2,4-dienoate hydrolase
     CYCME_1631
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Say1_Mug180 FSH1 DUF1057 Esterase Peptidase_S9 Abhydrolase_4 DUF915 BAAT_C
Other DBs
NCBI-ProteinID: AGS39956
UniProt: S5T834
LinkDB
Position
complement(1639095..1639931)
AA seq 278 aa
MNIENESLYEKKYIDVDGINTCYIEAGEGEPLVLIHGGGAGANGYGNWFACLPLFAKSFR
TIAVDMVGFGLTDSPDPSDFEYSQKARYEHIANFIKKMGLEKVNLVGNSMGGATAMGVAV
EYPELCERLILMGSAGLNTELDIAALKPVLGYDYTKEGMIRLIKVLTNDSFQITSEMIDY
RHANSVDPKNEASYAATMDWVRKAGGLFYEEDYIASVQQKTLVVNGKDDQVVPLSSAHKF
LELMDNSWGYIMPHCGHWAMIEYPDDFSSAVSAFIKSH
NT seq 837 nt   +upstreamnt  +downstreamnt
ttgaatatagaaaatgaatcactatatgaaaagaaatatattgatgtggatggtattaac
acttgttatatagaagccggcgagggtgagccattagtgttaatacatggtggtggcgct
ggcgcaaatggctacggaaattggtttgcttgtttgccgttgtttgccaaaagctttaga
accatcgctgttgatatggtgggctttggtttaacagatagccctgaccccagtgatttt
gaatattcacaaaaagcacgttatgaacatattgctaactttattaaaaaaatggggtta
gagaaagtcaaccttgttggtaattcaatgggtggagcaacagccatgggggttgccgtt
gagtacccagaactgtgtgagaggcttatcttaatgggcagtgctgggctaaatacagag
ttggatatagcagcgcttaagcctgttttagggtatgactatacaaaagaagggatgata
aggctgataaaggttctcactaatgattcgtttcaaattacctcagaaatgattgattac
cgacacgcaaactcagtagacccaaaaaatgaagcctcttatgcggcgactatggactgg
gttagaaaagcagggggcttgttttatgaagaagactatattgccagcgtgcaacaaaaa
acactggttgtgaatggtaaagacgaccaagtggttcctttatcgagtgcacataaattt
ttagagttaatggataactcatggggttatatcatgccgcactgtggtcattgggcgatg
attgagtaccccgacgacttttctagtgccgtgtcggcttttataaaatcgcactag

DBGET integrated database retrieval system