KEGG   Cycloclasticus zancles: CYCME_1641Help
Entry
CYCME_1641        CDS       T02780                                 

Definition
(GenBank) 2,3-dihydroxybiphenyl 1,2-dioxygenase
Organism
cza  Cycloclasticus zancles
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_2
Motif
Other DBs
NCBI-ProteinID: AGS39966
UniProt: S5T840
LinkDB All DBs
Position
complement(1650129..1651043)
Genome map
AA seq 304 aa AA seqDB search
MNLDQLTPSSLGYFVFKSDKLAEWNTFLKDLVGLQLSDKSSDDQLAFRMDKQEQRIIIEK
GSANDLSAVGWEYDNDQSLNEVVLHIKGKGVEIVKADQKFCESRGIRKAYICTDPDGVDH
ELYYGASIIPMNDSFKSDVLVGQFLADRFGAGHYVANAENVEMSLNFYRNVLCIRLSDYI
TGEVFPGGPVLEATFLHTKTGRHHSVACASIPIPKKLHHFMIEYENMNDVGLAFDRFKKA
DTPFFMELGHHPNDQMFSFYVQTPDGFGLEIGWGGIIIEEDNWEVKTYSQLSDWGHVEPR
SNDN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagatcaattaactccatccagtttgggatattttgtttttaaatccgataaa
ttggcggaatggaacacttttttaaaggacctagttggtctgcagcttagtgacaaaagt
agtgacgatcaacttgcttttcgtatggataagcaagaacaacgaatcattattgaaaaa
gggtcagcaaatgatttatcagcagtcggttgggaatatgataatgatcaatcgctgaat
gaagtcgttctacatatcaaaggaaagggtgttgagattgtaaaagcagaccagaagttt
tgtgaaagtagggggattaggaaagcctatatttgcacagacccggatggggttgatcat
gaactatattatggcgcatcgattatcccgatgaatgacagttttaaatcggatgttttg
gttgggcaatttttagctgatcgttttggtgctggtcactatgttgctaatgctgaaaat
gttgagatgagtcttaacttttataggaatgtattgtgtattcgattaagcgattatatc
accggtgaggtttttcctggtgggccagtattagaagctacttttttacatacaaaaact
ggcagacaccattctgtcgcctgtgcaagtatcccaatacctaaaaagctacatcatttt
atgatcgagtatgaaaatatgaatgacgttggtctcgcttttgatcgctttaaaaaggct
gatacacctttttttatggagcttggtcatcacccaaatgatcaaatgttttctttctat
gttcaaacacccgatggttttggtttagaaattggttggggcggaataatcatagaagaa
gataattgggaagttaaaacgtattcccaattaagtgattggggtcatgttgaacctaga
tcaaatgacaactaa

DBGET integrated database retrieval system