KEGG   Cycloclasticus zancles: CYCME_1642Help
Entry
CYCME_1642        CDS       T02780                                 

Definition
(GenBank) TetR family transcriptional regulator
  KO
K23777  TetR/AcrR family transcriptional regulator, regulator of cefoperazone and chloramphenicol sensitivity
Organism
cza  Cycloclasticus zancles
Brite
KEGG Orthology (KO) [BR:cza00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cza03000]
    CYCME_1642
Transcription factors [BR:cza03000]
 Prokaryotic type
  Helix-turn-helix
   TetR/AcrR family
    CYCME_1642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N MRC1
Motif
Other DBs
NCBI-ProteinID: AGS39967
UniProt: S5TGH4
LinkDB All DBs
Position
complement(1651685..1652281)
Genome map
AA seq 198 aa AA seqDB search
MKLSKGLDKKNKIFDVALTLFSKYGFKAVTMREIAAKSSTSLGSLYIHYKSKAELYDMVL
DSAYLEHAKAWRVTSDPDETLESKLYRFINNFCHFMNDNVEVAKLFKREQLDADPKRIKK
LAEKVLSEEYNNLKELVIEANPTCHADVTTVLIFGMALNYYETMEFRKYFPGYDDSINSP
DFIAEQIFNMAIAGLKST
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatcgaaaggattggataagaaaaataaaatatttgatgttgcgttaacgcta
ttttcaaaatatggctttaaggcagttactatgagagagatagctgctaaatcatcgacc
agtctcggttccttatatattcactataaatcaaaggcagagttatatgacatggtttta
gatagtgcttaccttgagcacgctaaagcatggcgagtaacctctgatcctgatgaaact
ttagaaagtaaactgtaccgatttataaataacttttgccactttatgaatgataacgtt
gaagtggcgaagctttttaaacgtgaacaactggatgctgatcctaagcgtattaagaag
cttgcagagaaggtattatccgaagaatataataatttaaaagagctagtgatagaggct
aaccctacatgtcatgcagatgtcacgacggttttgatttttggtatggcactaaattat
tatgaaacgatggaatttagaaaatactttcctggttatgatgattccatcaatagtcca
gattttattgcagagcaaatatttaatatggcaatagcggggcttaaaagtacgtaa

DBGET integrated database retrieval system