KEGG   Desulfofarcimen acetoxidans: Dtox_0030
Entry
Dtox_0030         CDS       T00986                                 

Definition
(GenBank) hypothetical protein
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
dae  Desulfofarcimen acetoxidans
Pathway
dae00300  Lysine biosynthesis
dae01100  Metabolic pathways
dae01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dae00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Dtox_0030
Enzymes [BR:dae01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     Dtox_0030
SSDB
Motif
Pfam: Shikimate_DH AlaDh_PNT_C 2-Hacid_dh_C 3HCDH_N NAD_binding_7 UDPG_MGDP_dh_N AdoHcyase_NAD FAD_binding_3 HI0933_like Pyr_redox_2 NAD_binding_2 TrkA_N PQQ Sacchrp_dh_NADP UDPG_MGDP_dh_C NAD_Gly3P_dh_N
Other DBs
NCBI-ProteinID: ACV60994
UniProt: C8VVD4
LinkDB
Position
32918..33733
AA seq 271 aa
MTRLREEDISHIPLNLNEYNKKLLKDTGKSLGGIAAYAAGTTKEIIYNLRQDIPAAVIPI
TCGEGIINGFSISVQRIIDFLGFSAFVTDQKDVGGLAEAVEKGAKIIFLADDNRFVAINI
LTGKVVDNGEATGKGYAAALDLLSGGLRDKQVLLIGAGPVGTGASVFMSTHGAKVFVYDI
NREQAEKLKKNLPEVEIINNFYEALSQYDLLFDASPAEGIIGKEHLGEHMMISAPGIPLG
LTRECLPLVPHRLIHDALEIGVATMLFDVLT
NT seq 816 nt   +upstreamnt  +downstreamnt
atgactagactgagagaagaggatatttcacatatccctttgaatctaaatgagtataat
aaaaaattgctaaaagacacaggtaaatctttagggggaattgcggcatatgctgccggt
actacaaaagagataatttataatttgcggcaggacataccggcagcagttattccaata
acctgtggagaaggtataattaacggattttccatatcagtccaaagaatcattgatttc
ctgggcttttcagcttttgttacagatcaaaaggatgtgggtggcctggcggaagcagtt
gagaagggtgctaagataatttttcttgccgacgacaaccgttttgttgcgattaatatt
ttaaccggtaaggtggttgataacggcgaggccacgggaaaaggctatgccgcggccctg
gatttattatcgggcggtttgcgggataagcaagtgcttttaatcggggctggacctgta
ggtaccggagcttcagtgtttatgtcaacacacggggcgaaggtttttgtatatgatatt
aacagagaacaggctgaaaagctgaaaaagaacctgccggaagttgaaataataaataac
ttttatgaggctttgtcccaatatgatttattatttgatgcttcgcctgccgaaggcata
attggtaaagagcacctgggtgagcatatgatgatatccgctcccgggattcctttgggt
ttaactcgggaatgccttccgctggttccccacaggttgattcacgatgctctggagata
ggtgtggcaactatgttgtttgatgttttaacttaa

DBGET integrated database retrieval system