KEGG   Dechloromonas aromatica: Daro_2863Help
Entry
Daro_2863         CDS       T00259                                 

Definition
(GenBank) succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
dar  Dechloromonas aromatica
Pathway
dar00020  Citrate cycle (TCA cycle)
dar00190  Oxidative phosphorylation
dar00650  Butanoate metabolism
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01120  Microbial metabolism in diverse environments
dar01130  Biosynthesis of antibiotics
dar01200  Carbon metabolism
Module
dar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dar_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Daro_2863
   00650 Butanoate metabolism
    Daro_2863
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Daro_2863
Enzymes [BR:dar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Daro_2863
    1.3.5.4  fumarate reductase (quinol)
     Daro_2863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 Thi4 FAD_binding_3 Pyr_redox_3 HI0933_like GIDA GMC_oxred_N NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AAZ47593
UniProt: Q47C38
LinkDB All DBs
Position
complement(3083173..3084957)
Genome map
AA seq 594 aa AA seqDB search
MSIPVLKFDAVIVGAGGAGLRSAIQLSEAGLKTAVLSKVFPTRSHTVAAQGGVAASLGNS
EEDHWTWHMYDTVKGSDWLGDQDAIEFMCKKANEVVVELEHYGMPFDRTDDGKIYQRPFG
GHMSNFGEKPVRRSCAAADRTGHAMLHAMYQRNVKANTQFFVEWMALDLIRDEEGHVLGV
TAMEMETGQIVIFHARATIFATGGAGRIFYSSTNAFINTGDGLGMAARAGIPLEDMEFWQ
FHPTGVAGAGVLITEGVRGEGGILRNSSKERFMERYAPNAKDLASRDVVSRAMATEIKEG
RGCGVNKDYVLLDITHLDPATIMKRLPGIHEIGLQFAGVDCLKEPLPVVPTCHYQMGGIP
THYSGRVVMPKNGDMNSVVPGFYAGGECACASVHGANRLGTNSLLDLLVFGKSAGDSAVE
DLKAGRAHRELPKDVADKTLARISALDNRKGGANVHETRLAMQRTMQDHAGVFRFGDMLK
QGVEKILEVEKAARQLEIKDKSMAWNTARTEALEMENLIEVAKATMISAEARKESRGAHV
RDDAPDTAEFPNGRNDKEWLKHTLFSPVDNSISYKPVNMQPLTVEAVALKTRSY
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
gtgagtattcctgttctcaagtttgatgcggtgatcgttggtgccggtggtgccggtctg
cgttccgcaatccaattgtccgaagctggcctgaaaacggccgtcttgtccaaagttttc
ccgacccgttcgcacactgttgcggcgcagggcggggttgctgcctcccttggtaattcc
gaggaagatcactggacgtggcacatgtacgataccgtcaagggttccgactggctcggc
gaccaggatgcgatcgaatttatgtgcaagaaggccaacgaagtggtcgttgagctcgag
cactacggcatgccttttgaccgtaccgacgacggcaagatctaccagcgtccgttcggt
ggtcacatgtcgaactttggcgaaaagccggtgcgtcgttcctgtgctgccgctgaccgt
accggtcatgccatgttgcacgccatgtaccagcgcaacgtcaaggccaacacccagttc
ttcgttgaatggatggcccttgacctgatccgtgacgaagaaggtcacgtcctcggcgtt
accgccatggaaatggaaaccggccagatcgttatcttccacgctcgtgccacgattttc
gccaccggcggtgccggccgtatcttctactcgtcgaccaatgctttcatcaataccggt
gacggccttggtatggcggcgcgtgctggcatcccgctcgaagacatggaattctggcag
ttccacccgaccggcgtggccggtgctggtgtgctgattaccgaaggtgtgcgcggcgaa
ggcggcattctgcgtaattccagcaaggaacgcttcatggagcgctacgctccgaacgcc
aaggatctggcgtcgcgtgatgtggtttcgcgcgccatggcgaccgaaatcaaggaaggc
cgcggttgtggcgtcaacaaggactacgtcctgctcgacatcacccatctcgatccagcc
actatcatgaagcgcctgccgggcatccacgaaatcggcctgcaattcgccggtgtcgat
tgcctgaaggaaccgctgccggtcgtgccgacctgtcactaccagatgggtggtatccca
acccattactctggccgtgtcgtcatgccgaagaatggcgacatgaacagcgtcgttcct
ggtttctatgccggtggcgagtgtgcctgtgcttcggtgcacggtgccaaccgtctcggt
accaattcgctgctcgatctgctggtcttcggcaagtcggccggcgactccgcggtcgaa
gatctcaaggctggccgcgcccatcgcgaactgccgaaggacgtcgccgacaagactctg
gctcgcatcagcgcactggacaaccgcaagggcggtgccaacgtgcacgaaacccgtctg
gccatgcagcgcaccatgcaggaccacgccggtgtgttccgttttggcgacatgctgaag
cagggcgtcgagaagatcctcgaagtcgaaaaggcagctcgccagctcgagatcaaggac
aagtcgatggcctggaatacggctcgtaccgaagcgctcgaaatggaaaacctgatcgaa
gtcgccaaggccacgatgatttccgccgaagcccgcaaggaatcccgtggtgctcatgtt
cgtgacgacgcgccggataccgccgagttcccgaatggccgtaacgacaaggaatggctg
aagcacacgctgttctcgccggttgataactcgatcagctacaagccggtcaacatgcaa
cccctgaccgtcgaggccgtagccctcaagacgcgctcgtactaa

DBGET integrated database retrieval system