KEGG   Desulfobacterium autotrophicum: HRM2_47910Help
Entry
HRM2_47910        CDS       T00861                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dat  Desulfobacterium autotrophicum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DisA_N
Motif
Other DBs
NCBI-ProteinID: ACN17840
UniProt: C0QHI1
LinkDB All DBs
Position
5415278..5416726
Genome map
AA seq 482 aa AA seqDB search
MDEFTFSHMCIKQTAEGLRDGLTHFSGPSRTAIIYSIKPEDPIYIYDPQNLLLGHEPKFK
ELYIDSDAWQKKTAIGYDKKKFSNLILEKNLELAGLISYGGRSSSVVYQMWFTEHHPDMC
SIGPTERWLEQTVWRLSHDVANEEDLYTGISGNFLKEYATHAVRDYIVDEMNVLIGWDTR
MRIYPILEAVLKISRTPEEGSWPKGKLIFVEKRSLAKLQFIAKFPKAERPELGKIKHIRK
LLQSVENSDRKLVADEKTIIGIIKGDCPVFSISAKFKGSYGFLALNNDKVCSFSDGCFQS
TTRKAKLVQVEEALLDSNMDSKDVATLFKMISEIVHNAANLRHGCAIVVDLNTPPVFISS
QCLEHPLDLKNHDEFELAKSLSRVDGALHITADLKLHEFACLLDGHHIPNEHRARGARFN
SALRFTAEHENVIVIVVSSDSPVSVMMDGGVLDAKCPLKSSIFCDAPMLLKKWVDSSESV
HS
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggatgagtttaccttttcacacatgtgtattaagcaaaccgcagaggggttgcgggat
ggactgacccatttttccgggccgagcaggactgcaataatttattcgattaaacccgaa
gatcccatctacatttatgatccacaaaacctgctgctcggtcatgagcccaagttcaag
gagttgtacattgattcagatgcatggcaaaaaaaaactgccatcgggtatgacaaaaaa
aaattcagcaatctgattctggaaaaaaatctggagctggccggactgatttcctacggg
ggacgatccagctcggttgtttaccagatgtggtttaccgaacaccatccagacatgtgc
tccatcggccccaccgaacgttggctcgaacaaaccgtctggcggttatcccatgatgtg
gccaatgaagaagacctgtatacagggatctcgggcaattttttgaaagagtatgccacc
catgcagtccgggactatatcgtggatgaaatgaatgtattgatcggatgggacacacgg
atgaggatctatcccattttagaagccgtactcaaaatatccagaaccccggaagagggt
tcatggccaaaaggcaagctgatcttcgtggaaaagcgctctctagccaaactgcagttc
attgcaaagtttcccaaagcagaacggcctgaactgggaaaaatcaaacatatcaggaag
ctgctccagagcgttgaaaactcagatcggaaacttgttgcagatgaaaaaacaatcatt
ggtataatcaagggtgactgtcctgttttttccatttctgccaaatttaaggggtcatac
ggatttttagcgctgaacaacgataaagtctgctctttttcagatggatgcttccagtca
accacccgcaaagcaaaacttgtacaggtggaagaggcattgctggattcaaacatggat
tctaaagatgtagccaccctgtttaaaatgatttccgaaattgttcacaatgccgcaaat
cttcgccatggctgcgccattgtggttgatctgaataccccccctgtttttatctcaagc
caatgtcttgaacacccccttgatcttaaaaaccatgacgaattcgaattggccaaatcc
ctgtcccgggtggacggtgccctccatatcacggctgatctgaaacttcacgaatttgcc
tgtctcctggacggtcatcatatcccgaatgagcacagggcccggggtgcacggtttaac
tcagccctgcgattcacggctgaacatgaaaatgtcattgtcatcgtggtctcttcggat
tctcctgtctcggtcatgatggacggcggggtgctggacgccaaatgtcccttgaaatca
tccatcttctgcgatgctcccatgctgctgaaaaaatgggtggattcctctgaatcggtg
cactcttga

DBGET integrated database retrieval system